Recombinant Human PAWR Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PAWR-459H
Product Overview : PAWR MS Standard C13 and N15-labeled recombinant protein (NP_002574) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases.
Molecular Mass : 36.6 kDa
AA Sequence : MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PAWR pro-apoptotic WT1 regulator [ Homo sapiens (human) ]
Official Symbol PAWR
Synonyms PAWR; PRKC, apoptosis, WT1, regulator; PRKC apoptosis WT1 regulator protein; par 4; PAR4; WT1-interacting protein; transcriptional repressor PAR4; prostate apoptosis response 4 protein; prostate apoptosis response protein 4; prostate apoptosis response protein PAR-4; Par-4;
Gene ID 5074
mRNA Refseq NM_002583
Protein Refseq NP_002574
MIM 601936
UniProt ID Q96IZ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAWR Products

Required fields are marked with *

My Review for All PAWR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon