Recombinant Human PAX2 protein, GST-tagged
Cat.No. : | PAX2-1750H |
Product Overview : | Recombinant Human PAX2 protein(180-229 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 180-229 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | DPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRD |
Gene Name | PAX2 paired box 2 [ Homo sapiens ] |
Official Symbol | PAX2 |
Synonyms | PAX2; paired box 2; paired box gene 2; paired box protein Pax-2; paired box homeotic gene 2; |
Gene ID | 5076 |
mRNA Refseq | NM_000278 |
Protein Refseq | NP_000269 |
MIM | 167409 |
UniProt ID | Q02962 |
◆ Recombinant Proteins | ||
PAX2-12391M | Recombinant Mouse PAX2 Protein | +Inquiry |
PAX2-6516M | Recombinant Mouse PAX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAX2-6356C | Recombinant Chicken PAX2 | +Inquiry |
PAX2-5598H | Recombinant Human PAX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAX2-1752H | Recombinant Human PAX2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX2-3419HCL | Recombinant Human PAX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX2 Products
Required fields are marked with *
My Review for All PAX2 Products
Required fields are marked with *