Recombinant Human PAX4

Cat.No. : PAX4-29532TH
Product Overview : Recombinant fragment corresponding to amino acids 121-217 of Human PAX4 isoform 3 with an N terminal proprietary tag; Predicted MWt 36.3 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 97 amino acids
Description : This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box 4 gene is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing beta cells.
Molecular Weight : 36.300kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKW
Sequence Similarities : Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.Contains 1 paired domain.
Gene Name PAX4 paired box 4 [ Homo sapiens ]
Official Symbol PAX4
Synonyms PAX4; paired box 4; paired box gene 4; paired box protein Pax-4; MODY9;
Gene ID 5078
mRNA Refseq NM_006193
Protein Refseq NP_006184
MIM 167413
Uniprot ID O43316
Chromosome Location 7q32.1
Pathway Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells, organism-specific biosystem;
Function DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAX4 Products

Required fields are marked with *

My Review for All PAX4 Products

Required fields are marked with *

0
cart-icon