Recombinant Human PAX8

Cat.No. : PAX8-29058TH
Product Overview : Recombinant full length Human PAX8 with a proprietary tag: predicted molecular weight 75.24 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 451 amino acids
Description : This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight : 75.240kDa inclusive of tags
Tissue specificity : Expressed in the excretory system, thyroid gland and Wilms tumors.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Sequence Similarities : Contains 1 paired domain.
Gene Name PAX8 paired box 8 [ Homo sapiens ]
Official Symbol PAX8
Synonyms PAX8; paired box 8; paired box gene 8; paired box protein Pax-8;
Gene ID 7849
mRNA Refseq NM_003466
Protein Refseq NP_003457
MIM 167415
Uniprot ID Q06710
Chromosome Location 2q13
Pathway Id Signaling Pathway, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Thyroid cancer, organism-specific biosystem; Thyroid cancer, conserved biosystem; Transcriptional misregulation in cancers, organism-specific biosystem;
Function DNA binding; DNA binding; RNA polymerase II core promoter sequence-specific DNA binding; protein binding; sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAX8 Products

Required fields are marked with *

My Review for All PAX8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon