Recombinant Human PAX8
Cat.No. : | PAX8-29058TH |
Product Overview : | Recombinant full length Human PAX8 with a proprietary tag: predicted molecular weight 75.24 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 451 amino acids |
Description : | This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Weight : | 75.240kDa inclusive of tags |
Tissue specificity : | Expressed in the excretory system, thyroid gland and Wilms tumors. |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL |
Sequence Similarities : | Contains 1 paired domain. |
Gene Name | PAX8 paired box 8 [ Homo sapiens ] |
Official Symbol | PAX8 |
Synonyms | PAX8; paired box 8; paired box gene 8; paired box protein Pax-8; |
Gene ID | 7849 |
mRNA Refseq | NM_003466 |
Protein Refseq | NP_003457 |
MIM | 167415 |
Uniprot ID | Q06710 |
Chromosome Location | 2q13 |
Pathway | Id Signaling Pathway, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Thyroid cancer, organism-specific biosystem; Thyroid cancer, conserved biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; |
Function | DNA binding; DNA binding; RNA polymerase II core promoter sequence-specific DNA binding; protein binding; sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
PAX8-360HF | Recombinant Full Length Human PAX8 Protein | +Inquiry |
PAX8-29058TH | Recombinant Human PAX8 | +Inquiry |
Pax8-4687M | Recombinant Mouse Pax8 Protein, Myc/DDK-tagged | +Inquiry |
PAX8-01H | Recombinant Human PAX8 Protein, C-Myc/DDK-Tagged | +Inquiry |
PAX8-02H | Recombinant Human PAX8 Protein, C-Myc/DDK tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX8-3412HCL | Recombinant Human PAX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX8 Products
Required fields are marked with *
My Review for All PAX8 Products
Required fields are marked with *
0
Inquiry Basket