Recombinant Human paxillin Protein, His-tagged

• Cat.No.: PXN-001H
• Product Overview: Recombinant human paxillin Protein (59-274 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 59-274aa
• Description: This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. These isoforms exhibit different expression pattern, and have different biochemical, as well as physiological properties.
• Tag: C-His
• Molecular Mass: 24 kDa
• AA Sequence: MNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSHHHHHHHH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: PXN paxillin [ Homo sapiens (human) ]
• Official Symbol: PXN
• Synonyms: PXN; paxillin; FLJ16691
• Gene ID: 5829
• mRNA Refseq: NM_001080855
• Protein Refseq: NP_001074324
• MIM: 602505
• UniProt ID: P49023