Recombinant Human paxillin Protein, His-tagged
Cat.No. : | PXN-001H |
Product Overview : | Recombinant human paxillin Protein (59-274 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 59-274aa |
Description : | This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. These isoforms exhibit different expression pattern, and have different biochemical, as well as physiological properties. |
Tag : | C-His |
Molecular Mass : | 24 kDa |
AA Sequence : | MNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSHHHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH 7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | PXN paxillin [ Homo sapiens (human) ] |
Official Symbol | PXN |
Synonyms | PXN; paxillin; FLJ16691; |
Gene ID | 5829 |
mRNA Refseq | NM_001080855 |
Protein Refseq | NP_001074324 |
MIM | 602505 |
UniProt ID | P49023 |
◆ Recombinant Proteins | ||
PXN-01H | Recombinant Human PXN Protein, His-tagged | +Inquiry |
Pxn-1875R | Recombinant Rat Pxn protein, His & T7-tagged | +Inquiry |
PXN-6123H | Recombinant Human PXN Protein (Lys201-Lys461), N-His tagged | +Inquiry |
Pxn-1874M | Recombinant Mouse Pxn protein, His & T7-tagged | +Inquiry |
PXN-4515R | Recombinant Rat PXN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PXN-2651HCL | Recombinant Human PXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PXN Products
Required fields are marked with *
My Review for All PXN Products
Required fields are marked with *
0
Inquiry Basket