Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PAXIP1 protein, His-tagged

Cat.No. : PAXIP1-3751H
Product Overview : Recombinant Human PAXIP1 protein(717-1069 aa), fused to His tag, was expressed in E. coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length : 717-1069 aa
AA Sequence : CENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name : PAXIP1 PAX interacting (with transcription-activation domain) protein 1 [ Homo sapiens ]
Official Symbol : PAXIP1
Synonyms : PAXIP1; PAX interacting (with transcription-activation domain) protein 1; PAX transcription activation domain interacting protein 1 like , PAXIP1L; PAX-interacting protein 1; CAGF28; CAGF29; PTIP; TNRC2; protein encoded by CAG trinucleotide repeats; PAX transcription activation domain interacting protein 1 like; PACIP1; PAXIP1L; FLJ41049;
Gene ID : 22976
mRNA Refseq : NM_007349
Protein Refseq : NP_031375
MIM : 608254
UniProt ID : Q6ZW49

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends