Recombinant Human PAXIP1 protein, His-tagged

Cat.No. : PAXIP1-3751H
Product Overview : Recombinant Human PAXIP1 protein(717-1069 aa), fused to His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 717-1069 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : CENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PAXIP1 PAX interacting (with transcription-activation domain) protein 1 [ Homo sapiens ]
Official Symbol PAXIP1
Synonyms PAXIP1; PAX interacting (with transcription-activation domain) protein 1; PAX transcription activation domain interacting protein 1 like , PAXIP1L; PAX-interacting protein 1; CAGF28; CAGF29; PTIP; TNRC2; protein encoded by CAG trinucleotide repeats; PAX transcription activation domain interacting protein 1 like; PACIP1; PAXIP1L; FLJ41049;
Gene ID 22976
mRNA Refseq NM_007349
Protein Refseq NP_031375
MIM 608254
UniProt ID Q6ZW49

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PAXIP1 Products

Required fields are marked with *

My Review for All PAXIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon