Recombinant Human PAXIP1 protein, His-tagged
| Cat.No. : | PAXIP1-3751H |
| Product Overview : | Recombinant Human PAXIP1 protein(717-1069 aa), fused to His tag, was expressed in E. coli. |
| Availability | October 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 717-1069 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | CENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PAXIP1 PAX interacting (with transcription-activation domain) protein 1 [ Homo sapiens ] |
| Official Symbol | PAXIP1 |
| Synonyms | PAXIP1; PAX interacting (with transcription-activation domain) protein 1; PAX transcription activation domain interacting protein 1 like , PAXIP1L; PAX-interacting protein 1; CAGF28; CAGF29; PTIP; TNRC2; protein encoded by CAG trinucleotide repeats; PAX transcription activation domain interacting protein 1 like; PACIP1; PAXIP1L; FLJ41049; |
| Gene ID | 22976 |
| mRNA Refseq | NM_007349 |
| Protein Refseq | NP_031375 |
| MIM | 608254 |
| UniProt ID | Q6ZW49 |
| ◆ Recombinant Proteins | ||
| PAXIP1-12399M | Recombinant Mouse PAXIP1 Protein | +Inquiry |
| PAXIP1-6521M | Recombinant Mouse PAXIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PAXIP1-3751H | Recombinant Human PAXIP1 protein, His-tagged | +Inquiry |
| PAXIP1-7542H | Recombinant Human PAXIP1 protein, His-tagged | +Inquiry |
| PAXIP1-1463Z | Recombinant Zebrafish PAXIP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAXIP1-3410HCL | Recombinant Human PAXIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAXIP1 Products
Required fields are marked with *
My Review for All PAXIP1 Products
Required fields are marked with *
