Recombinant Human PAXIP1 protein, His-tagged
Cat.No. : | PAXIP1-3751H |
Product Overview : | Recombinant Human PAXIP1 protein(717-1069 aa), fused to His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 717-1069 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PAXIP1 PAX interacting (with transcription-activation domain) protein 1 [ Homo sapiens ] |
Official Symbol | PAXIP1 |
Synonyms | PAXIP1; PAX interacting (with transcription-activation domain) protein 1; PAX transcription activation domain interacting protein 1 like , PAXIP1L; PAX-interacting protein 1; CAGF28; CAGF29; PTIP; TNRC2; protein encoded by CAG trinucleotide repeats; PAX transcription activation domain interacting protein 1 like; PACIP1; PAXIP1L; FLJ41049; |
Gene ID | 22976 |
mRNA Refseq | NM_007349 |
Protein Refseq | NP_031375 |
MIM | 608254 |
UniProt ID | Q6ZW49 |
◆ Recombinant Proteins | ||
PAXIP1-3751H | Recombinant Human PAXIP1 protein, His-tagged | +Inquiry |
PAXIP1-7542H | Recombinant Human PAXIP1 protein, His-tagged | +Inquiry |
PAXIP1-1463Z | Recombinant Zebrafish PAXIP1 | +Inquiry |
PAXIP1-6521M | Recombinant Mouse PAXIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAXIP1-12399M | Recombinant Mouse PAXIP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAXIP1-3410HCL | Recombinant Human PAXIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAXIP1 Products
Required fields are marked with *
My Review for All PAXIP1 Products
Required fields are marked with *