Recombinant Human PCBD1 protein, GST-tagged
| Cat.No. : | PCBD1-1804H |
| Product Overview : | Recombinant Human PCBD1 protein(1-104 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 10, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-104 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PCBD1 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [ Homo sapiens ] |
| Official Symbol | PCBD1 |
| Synonyms | PCBD1; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) , DCOH, PCBD, pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); pterin-4-alpha-carbinolamine dehydratase; dimerizing cofactor for HNF1; PCD; pterin 4 alpha carbinolamine dehydratase; Pterin 4a carbinolamine dehydratase (dimerization cofactor of hepatic nuclear factor 1 alpha); dimerization cofactor of HNF1; 4-alpha-hydroxy-tetrahydropterin dehydratase; phenylalanine hydroxylase-stimulating protein; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); PHS; DCOH; PCBD; |
| Gene ID | 5092 |
| mRNA Refseq | NM_000281 |
| Protein Refseq | NP_000272 |
| MIM | 126090 |
| UniProt ID | P61457 |
| ◆ Recombinant Proteins | ||
| PCBD1-6467C | Recombinant Chicken PCBD1 | +Inquiry |
| PCBD1-3134R | Recombinant Rhesus Macaque PCBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCBD1-30550TH | Recombinant Human PCBD1, His-tagged | +Inquiry |
| PCBD1-2809H | Recombinant Human PCBD1, His-tagged | +Inquiry |
| PCBD1-3953R | Recombinant Rat PCBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCBD1-385HKCL | Human PCBD1 Knockdown Cell Lysate | +Inquiry |
| PCBD1-3405HCL | Recombinant Human PCBD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCBD1 Products
Required fields are marked with *
My Review for All PCBD1 Products
Required fields are marked with *
