Recombinant Human PCBD1 protein, His-GST-tagged
Cat.No. : | PCBD1-3321H |
Product Overview : | Recombinant Human PCBD1 protein(P61457)(2-104aa), fused to N-terminal His-GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 2-104aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.9 kDa |
AA Sequence : | AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PCBD1 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [ Homo sapiens ] |
Official Symbol | PCBD1 |
Synonyms | PCBD1; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) , DCOH, PCBD, pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); pterin-4-alpha-carbinolamine dehydratase; dimerizing cofactor for HNF1; PCD; pterin 4 alpha carbinolamine dehydratase; Pterin 4a carbinolamine dehydratase (dimerization cofactor of hepatic nuclear factor 1 alpha); dimerization cofactor of HNF1; 4-alpha-hydroxy-tetrahydropterin dehydratase; phenylalanine hydroxylase-stimulating protein; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); PHS; DCOH; PCBD; |
Gene ID | 5092 |
mRNA Refseq | NM_000281 |
Protein Refseq | NP_000272 |
MIM | 126090 |
UniProt ID | P61457 |
◆ Recombinant Proteins | ||
PCBD1-1088H | Recombinant Human PCBD1 protein, His-tagged | +Inquiry |
PCBD1-1804H | Recombinant Human PCBD1 protein, GST-tagged | +Inquiry |
PCBD1-30550TH | Recombinant Human PCBD1, His-tagged | +Inquiry |
PCBD1-3134R | Recombinant Rhesus Macaque PCBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCBD1-3321H | Recombinant Human PCBD1 protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBD1-3405HCL | Recombinant Human PCBD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCBD1 Products
Required fields are marked with *
My Review for All PCBD1 Products
Required fields are marked with *
0
Inquiry Basket