Recombinant Human PCBD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PCBD2-5144H |
Product Overview : | PCBD2 MS Standard C13 and N15-labeled recombinant protein (NP_115527) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PCBD2 (Pterin-4 Alpha-Carbinolamine Dehydratase 2) is a Protein Coding gene. Diseases associated with PCBD2 include Arthrogryposis, Distal, Type 6. Among its related pathways are Metabolism and Folate biosynthesis. Gene Ontology (GO) annotations related to this gene include phenylalanine 4-monooxygenase activity and 4-alpha-hydroxytetrahydrobiopterin dehydratase activity. An important paralog of this gene is PCBD1. |
Molecular Mass : | 14.4 kDa |
AA Sequence : | MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PCBD2 pterin-4 alpha-carbinolamine dehydratase 2 [ Homo sapiens (human) ] |
Official Symbol | PCBD2 |
Synonyms | PCBD2; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; pterin-4-alpha-carbinolamine dehydratase 2; DCOH2; DCOHM; PHS 2; DcoH-like protein DCoHm; HNF-1-alpha dimerization cofactor; pterin-4 alpha-carbinolamine dehydratase 2; 4-alpha-hydroxy-tetrahydropterin dehydratase 2; dimerization cofactor of hepatocyte nuclear factor 1 from muscle; dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; PHS2; |
Gene ID | 84105 |
mRNA Refseq | NM_032151 |
Protein Refseq | NP_115527 |
MIM | 609836 |
UniProt ID | Q9H0N5 |
◆ Recombinant Proteins | ||
PCBD2-5777C | Recombinant Chicken PCBD2 | +Inquiry |
PCBD2-5144H | Recombinant Human PCBD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Pcbd2-4695M | Recombinant Mouse Pcbd2 Protein, Myc/DDK-tagged | +Inquiry |
PCBD2-1547H | Recombinant Human PCBD2, GST-tagged | +Inquiry |
PCBD2-6531M | Recombinant Mouse PCBD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBD2-3404HCL | Recombinant Human PCBD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCBD2 Products
Required fields are marked with *
My Review for All PCBD2 Products
Required fields are marked with *