Recombinant Human PCBD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PCBD2-5144H
Product Overview : PCBD2 MS Standard C13 and N15-labeled recombinant protein (NP_115527) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PCBD2 (Pterin-4 Alpha-Carbinolamine Dehydratase 2) is a Protein Coding gene. Diseases associated with PCBD2 include Arthrogryposis, Distal, Type 6. Among its related pathways are Metabolism and Folate biosynthesis. Gene Ontology (GO) annotations related to this gene include phenylalanine 4-monooxygenase activity and 4-alpha-hydroxytetrahydrobiopterin dehydratase activity. An important paralog of this gene is PCBD1.
Molecular Mass : 14.4 kDa
AA Sequence : MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PCBD2 pterin-4 alpha-carbinolamine dehydratase 2 [ Homo sapiens (human) ]
Official Symbol PCBD2
Synonyms PCBD2; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; pterin-4-alpha-carbinolamine dehydratase 2; DCOH2; DCOHM; PHS 2; DcoH-like protein DCoHm; HNF-1-alpha dimerization cofactor; pterin-4 alpha-carbinolamine dehydratase 2; 4-alpha-hydroxy-tetrahydropterin dehydratase 2; dimerization cofactor of hepatocyte nuclear factor 1 from muscle; dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2; PHS2;
Gene ID 84105
mRNA Refseq NM_032151
Protein Refseq NP_115527
MIM 609836
UniProt ID Q9H0N5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCBD2 Products

Required fields are marked with *

My Review for All PCBD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon