Recombinant Human PCDH9 protein, GST-tagged

Cat.No. : PCDH9-332H
Product Overview : Recombinant Human PCDH9 protein(NP_065136)(1146-1237 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1146-1237 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : PGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PCDH9 protocadherin 9 [ Homo sapiens (human) ]
Official Symbol PCDH9
Synonyms PCDH9; protocadherin 9; protocadherin-9; cadherin superfamily protein VR4-11
Gene ID 5101
mRNA Refseq NM_020403
Protein Refseq NP_065136
MIM 603581
UniProt ID Q9HC56

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCDH9 Products

Required fields are marked with *

My Review for All PCDH9 Products

Required fields are marked with *

0
cart-icon
0
compare icon