Recombinant Human PCDH9 protein, GST-tagged
Cat.No. : | PCDH9-332H |
Product Overview : | Recombinant Human PCDH9 protein(NP_065136)(1146-1237 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1146-1237 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PCDH9 protocadherin 9 [ Homo sapiens (human) ] |
Official Symbol | PCDH9 |
Synonyms | PCDH9; protocadherin 9; protocadherin-9; cadherin superfamily protein VR4-11 |
Gene ID | 5101 |
mRNA Refseq | NM_020403 |
Protein Refseq | NP_065136 |
MIM | 603581 |
UniProt ID | Q9HC56 |
◆ Recombinant Proteins | ||
PCDH9-3321R | Recombinant Rhesus monkey PCDH9 Protein, His-tagged | +Inquiry |
PCDH9-332H | Recombinant Human PCDH9 protein, GST-tagged | +Inquiry |
PCDH9-3139R | Recombinant Rhesus Macaque PCDH9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCDH9 Products
Required fields are marked with *
My Review for All PCDH9 Products
Required fields are marked with *
0
Inquiry Basket