Recombinant Human PCDH9 protein, GST-tagged

• Cat.No.: PCDH9-332H
• Product Overview: Recombinant Human PCDH9 protein(NP_065136)(1146-1237 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1146-1237 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: PGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PCDH9 protocadherin 9 [ Homo sapiens (human) ]
• Official Symbol: PCDH9
• Synonyms: PCDH9; protocadherin 9; protocadherin-9; cadherin superfamily protein VR4-11
• Gene ID: 5101
• mRNA Refseq: NM_020403
• Protein Refseq: NP_065136
• MIM: 603581
• UniProt ID: Q9HC56