"PCDHB12" Related Products

Recombinant Human PCDHB12 protein, AFPn/His-tagged

Cat.No.: PCDHB12-101H
Product Overview: Recombinant human PCDHB12 cDNA (27–690aa, derived from BC045637) fused with a human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site (219aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: AFPn/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGSGSETGNF LVMEELQSGSFVGNLAKTLGLEVSELSSRGARVVSNDNKECLQLDTNTGDLLLREMLDREELCGSNEPCVLYFQV LMKNPTQFLQIELQVRDINDHSPVFLEKEMLLEIPENSPVGAVFLLESAKDLDVGINAVKSYTINPNSHFHVKIR VNPDNRKYPELVLDKALDYEERPELSFILTALDGGSPPRSGTALVRVVVVDINDNSPEFEQAFYEVKILENSILG SLVVTVSAWDLDSGTNSELSYTFSHASEDIRKTFEINQKSGDITLTAPLDFEAIESYSIIIQATDGGGLFGKSTV RIQVMDVNDNAPEITVSSITSPIPENTPETVVMVFRIRDRDSGDNGKMVCSIPEDIPFVLKSSVNNYYTLETERP LDRESRAEYNITITVTDLGTPRLKTEHNITVLVSDVNDNAPAFTQTSYALFVRENNSPALHIGSISATDRDSGTN AQVNYSLLPSQDPHLPLASLVSINADNGHLFALRSLDYEALQGFQFRVGATDHGSPALSSEALVRVLVLDANDNS PFVLYPLQNGSAPCTELVPWAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSER DAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYL
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro PCDHB12 mediated neuronal cell communication regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as PCDHB12 protein-protein interaction assay.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: PCDHB12 protocadherin beta 12 [ Homo sapiens ]
Official Symbol: PCDHB12
Synonyms: PCDHB12; protocadherin beta 12; protocadherin beta-12; PCDH BETA12; PCDH-beta-12; PCDH-BETA12;
Gene ID: 56124
mRNA Refseq: NM_018932
Protein Refseq: NP_061755
MIM: 606338
UniProt ID: Q9Y5F1
Chromosome Location: 5q31
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.