Recombinant Human PCID2 Protein, 80-399aa, N-His tagged

Cat.No. : PCID2-13H
Product Overview : Recombinant human PC1D2 protein (80-399aa), fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 80-399aa
Description : PCID2 is expressed in immature and early-stage B lymphocytes and regulates expression of the mitotic checkpoint protein MAD2.
Form : Liquid
Molecular Mass : 39.3 kDa (341aa)
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE, Denatured
Stability : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea
References : 1. Ota T., Suzuki Y. et al.,(2004), Nat. Genet. 36:40-45
Gene Name PCID2 PCI domain containing 2 [ Homo sapiens (human) ]
Official Symbol PCID2
Synonyms PCID2; PCI domain containing 2; PCI domain-containing protein 2; FLJ11305; CSN12-like protein; F10; RP11-98F14.6; FLJ99362; MGC16774; DKFZp686C20226
Gene ID 55795
mRNA Refseq NM_001127202
Protein Refseq NP_001120674
MIM 613713
UniProt ID Q5JVF3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCID2 Products

Required fields are marked with *

My Review for All PCID2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon