Recombinant Human PCID2 Protein, 80-399aa, N-His tagged
| Cat.No. : | PCID2-13H |
| Product Overview : | Recombinant human PC1D2 protein (80-399aa), fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 80-399aa |
| Description : | PCID2 is expressed in immature and early-stage B lymphocytes and regulates expression of the mitotic checkpoint protein MAD2. |
| Form : | Liquid |
| Molecular Mass : | 39.3 kDa (341aa) |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC |
| Purity : | > 85% by SDS-PAGE |
| Applications : | SDS-PAGE, Denatured |
| Stability : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea |
| References : | 1. Ota T., Suzuki Y. et al.,(2004), Nat. Genet. 36:40-45 |
| Gene Name | PCID2 PCI domain containing 2 [ Homo sapiens (human) ] |
| Official Symbol | PCID2 |
| Synonyms | PCID2; PCI domain containing 2; PCI domain-containing protein 2; FLJ11305; CSN12-like protein; F10; RP11-98F14.6; FLJ99362; MGC16774; DKFZp686C20226 |
| Gene ID | 55795 |
| mRNA Refseq | NM_001127202 |
| Protein Refseq | NP_001120674 |
| MIM | 613713 |
| UniProt ID | Q5JVF3 |
| ◆ Recombinant Proteins | ||
| PCID2-12494M | Recombinant Mouse PCID2 Protein | +Inquiry |
| PCID2-1413C | Recombinant Chicken PCID2 | +Inquiry |
| PCID2-4235H | Recombinant Human PCID2 Protein, GST-tagged | +Inquiry |
| PCID2-1767Z | Recombinant Zebrafish PCID2 | +Inquiry |
| PCID2-4854HF | Recombinant Full Length Human PCID2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCID2-630HCL | Recombinant Human PCID2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCID2 Products
Required fields are marked with *
My Review for All PCID2 Products
Required fields are marked with *
