Recombinant Human PCID2 Protein, 80-399aa, N-His tagged

• Cat.No.: PCID2-13H
• Product Overview: Recombinant human PC1D2 protein (80-399aa), fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 80-399aa
• Description: PCID2 is expressed in immature and early-stage B lymphocytes and regulates expression of the mitotic checkpoint protein MAD2.
• Form: Liquid
• Molecular Mass: 39.3 kDa (341aa)
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE, Denatured
• Stability: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea
• References: 1. Ota T., Suzuki Y. et al.,(2004), Nat. Genet. 36:40-45

Gene Information

• Gene Name: PCID2 PCI domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: PCID2
• Synonyms: PCID2; PCI domain containing 2; PCI domain-containing protein 2; FLJ11305; CSN12-like protein; F10; RP11-98F14.6; FLJ99362; MGC16774; DKFZp686C20226
• Gene ID: 55795
• mRNA Refseq: NM_001127202
• Protein Refseq: NP_001120674
• MIM: 613713
• UniProt ID: Q5JVF3