Recombinant Full Length Human PCID2 Protein, GST-tagged
| Cat.No. : | PCID2-4854HF |
| Product Overview : | Human FLJ11305 full-length ORF ( AAH16614, 1 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 399 amino acids |
| Description : | This gene encodes a component of the TREX-2 complex (transcription and export complex 2), which regulates mRNA export from the nucleus. This protein regulates expression of Mad2 mitotic arrest deficient-like 1, a cell division checkpoint protein. This protein also interacts with and stabilizes Brca2 (breast cancer 2) protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
| Molecular Mass : | 69.63 kDa |
| AA Sequence : | MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLLKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYVSHQHQKLVVSKQNPFPPLSTVC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PCID2 PCI domain containing 2 [ Homo sapiens ] |
| Official Symbol | PCID2 |
| Synonyms | PCID2; PCI domain containing 2; PCI domain-containing protein 2; FLJ11305; CSN12-like protein; F10; RP11-98F14.6; FLJ99362; MGC16774; DKFZp686C20226; |
| Gene ID | 55795 |
| mRNA Refseq | NM_001127202 |
| Protein Refseq | NP_001120674 |
| MIM | 613713 |
| UniProt ID | Q5JVF3 |
| ◆ Recombinant Proteins | ||
| PCID2-13H | Recombinant Human PCID2 Protein, 80-399aa, N-His tagged | +Inquiry |
| PCID2-12494M | Recombinant Mouse PCID2 Protein | +Inquiry |
| PCID2-4854HF | Recombinant Full Length Human PCID2 Protein, GST-tagged | +Inquiry |
| PCID2-6552M | Recombinant Mouse PCID2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCID2-4235H | Recombinant Human PCID2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCID2-630HCL | Recombinant Human PCID2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCID2 Products
Required fields are marked with *
My Review for All PCID2 Products
Required fields are marked with *
