Recombinant Human PCNA Protein
Cat.No. : | PCNA-066H |
Product Overview : | Recombinant human PCNA protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 261 |
Description : | The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. |
Form : | Solution |
Molecular Mass : | 28.8 kDa |
AA Sequence : | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
Purity : | > 95% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | Tris (pH 7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | PCNA proliferating cell nuclear antigen [ Homo sapiens (human) ] |
Official Symbol | PCNA |
Synonyms | PCNA; proliferating cell nuclear antigen; cyclin; DNA polymerase delta auxiliary protein; MGC8367; |
Gene ID | 5111 |
mRNA Refseq | NM_002592 |
Protein Refseq | NP_002583 |
MIM | 176740 |
UniProt ID | P12004 |
◆ Recombinant Proteins | ||
PCNA-518C | Recombinant Cynomolgus Monkey PCNA Protein, His (Fc)-Avi-tagged | +Inquiry |
PCNA-626H | Recombinant Human PCNA Protein, MYC/DDK-tagged | +Inquiry |
PCNA-536H | Recombinant Human Proliferating Cell Nuclear Antigen | +Inquiry |
PCNA-6999H | Recombinant Human PCNA protein, His-tagged | +Inquiry |
PCNA-4302R | Recombinant Rat PCNA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCNA-500HCL | Recombinant Human PCNA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCNA Products
Required fields are marked with *
My Review for All PCNA Products
Required fields are marked with *
0
Inquiry Basket