Recombinant Human PCOLCE
| Cat.No. : | PCOLCE-30795TH |
| Product Overview : | Recombinant full length Human PCOLCE with N terminal proprietary tag; predicted MW: 75kDa inclusive of tag.AAH00574.1, Q15113. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 449 amino acids |
| Description : | Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity. |
| Molecular Weight : | 75.000kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGD VKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFR VFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCG GRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV PGSISSEGNELLVQF |
| Sequence Similarities : | Contains 2 CUB domains.Contains 1 NTR domain. |
| Gene Name | PCOLCE procollagen C-endopeptidase enhancer [ Homo sapiens ] |
| Official Symbol | PCOLCE |
| Synonyms | PCOLCE; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; PCPE; PCPE1; procollagen C proteinase enhancer 1; procollagen; type 1; COOH terminal proteinase enhancer; |
| Gene ID | 5118 |
| mRNA Refseq | NM_002593 |
| Protein Refseq | NP_002584 |
| MIM | 600270 |
| Uniprot ID | Q15113 |
| Chromosome Location | 7q22 |
| Function | collagen binding; heparin binding; peptidase activator activity; |
| ◆ Recombinant Proteins | ||
| PCOLCE-6802H | Recombinant Human PCOLCE protein, His & S-tagged | +Inquiry |
| PCOLCE-30795TH | Recombinant Human PCOLCE | +Inquiry |
| PCOLCE-3966R | Recombinant Rat PCOLCE Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCOLCE-838H | Recombinant Human PCOLCE, T7-tagged | +Inquiry |
| Pcolce-6803M | Recombinant Mouse Pcolce protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCOLCE-3375HCL | Recombinant Human PCOLCE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCOLCE Products
Required fields are marked with *
My Review for All PCOLCE Products
Required fields are marked with *



