Recombinant Human PCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PCP2-1986H |
Product Overview : | PCP2 MS Standard C13 and N15-labeled recombinant protein (NP_777555) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May function as a cell-type specific modulator for G protein-mediated cell signaling. |
Molecular Mass : | 14.5 kDa |
AA Sequence : | MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PCP2 Purkinje cell protein 2 [ Homo sapiens (human) ] |
Official Symbol | PCP2 |
Synonyms | PCP2; GPSM4; Purkinje cell protein 2; Purkinje cell protein 2 homolog; Purkinje cell-specific protein L7 |
Gene ID | 126006 |
mRNA Refseq | NM_174895 |
Protein Refseq | NP_777555 |
UniProt ID | Q8IVA1 |
◆ Recombinant Proteins | ||
Pcp2-4718M | Recombinant Mouse Pcp2 Protein, Myc/DDK-tagged | +Inquiry |
PCP2-1986H | Recombinant Human PCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCP2-3150R | Recombinant Rhesus Macaque PCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCP2-3332R | Recombinant Rhesus monkey PCP2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCP2-3373HCL | Recombinant Human PCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCP2 Products
Required fields are marked with *
My Review for All PCP2 Products
Required fields are marked with *