Recombinant Human PCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PCP2-1986H
• Product Overview: PCP2 MS Standard C13 and N15-labeled recombinant protein (NP_777555) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May function as a cell-type specific modulator for G protein-mediated cell signaling.
• Molecular Mass: 14.5 kDa
• AA Sequence: MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PCP2 Purkinje cell protein 2 [ Homo sapiens (human) ]
• Official Symbol: PCP2
• Synonyms: PCP2; GPSM4; Purkinje cell protein 2; Purkinje cell protein 2 homolog; Purkinje cell-specific protein L7
• Gene ID: 126006
• mRNA Refseq: NM_174895
• Protein Refseq: NP_777555
• UniProt ID: Q8IVA1