Recombinant Human PCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PCP2-1986H
Product Overview : PCP2 MS Standard C13 and N15-labeled recombinant protein (NP_777555) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May function as a cell-type specific modulator for G protein-mediated cell signaling.
Molecular Mass : 14.5 kDa
AA Sequence : MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PCP2 Purkinje cell protein 2 [ Homo sapiens (human) ]
Official Symbol PCP2
Synonyms PCP2; GPSM4; Purkinje cell protein 2; Purkinje cell protein 2 homolog; Purkinje cell-specific protein L7
Gene ID 126006
mRNA Refseq NM_174895
Protein Refseq NP_777555
UniProt ID Q8IVA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCP2 Products

Required fields are marked with *

My Review for All PCP2 Products

Required fields are marked with *

0
cart-icon