Recombinant Human PCP4 protein, His-tagged
| Cat.No. : | PCP4-3485H |
| Product Overview : | Recombinant Human PCP4 protein(1-62 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-62 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PCP4 Purkinje cell protein 4 [ Homo sapiens ] |
| Official Symbol | PCP4 |
| Synonyms | PCP4; Purkinje cell protein 4; PEP 19; brain-specific antigen PCP-4; brain specific polypeptide PEP19; brain-specific polypeptide PEP-19; PEP-19; |
| Gene ID | 5121 |
| mRNA Refseq | NM_006198 |
| Protein Refseq | NP_006189 |
| MIM | 601629 |
| UniProt ID | P48539 |
| ◆ Recombinant Proteins | ||
| PCP4-3485H | Recombinant Human PCP4 protein, His-tagged | +Inquiry |
| PCP4-1582H | Recombinant Human PCP4, GST-tagged | +Inquiry |
| PCP4-12511M | Recombinant Mouse PCP4 Protein | +Inquiry |
| Pcp4-4719M | Recombinant Mouse Pcp4 Protein, Myc/DDK-tagged | +Inquiry |
| PCP4-4056H | Recombinant Human PCP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCP4-3372HCL | Recombinant Human PCP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCP4 Products
Required fields are marked with *
My Review for All PCP4 Products
Required fields are marked with *



