Recombinant Human PCP4L1 protein, GST-tagged

Cat.No. : PCP4L1-3651H
Product Overview : Recombinant Human PCP4L1 protein(1-68 aa), fused to GST tag, was expressed in E. coli.
Availability November 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-68 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PCP4L1 Purkinje cell protein 4 like 1 [ Homo sapiens (human) ]
Official Symbol PCP4L1
Synonyms PCP4L1; IQM1; Purkinje cell protein 4 like 1; Purkinje cell protein 4-like protein 1; PCP4-like protein 1
Gene ID 654790
mRNA Refseq NM_001102566
Protein Refseq NP_001096036
UniProt ID A6NKN8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCP4L1 Products

Required fields are marked with *

My Review for All PCP4L1 Products

Required fields are marked with *

0
cart-icon
0
compare icon