Recombinant Human PCP4L1 protein, GST-tagged
| Cat.No. : | PCP4L1-3651H |
| Product Overview : | Recombinant Human PCP4L1 protein(1-68 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-68 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PCP4L1 Purkinje cell protein 4 like 1 [ Homo sapiens (human) ] |
| Official Symbol | PCP4L1 |
| Synonyms | PCP4L1; IQM1; Purkinje cell protein 4 like 1; Purkinje cell protein 4-like protein 1; PCP4-like protein 1 |
| Gene ID | 654790 |
| mRNA Refseq | NM_001102566 |
| Protein Refseq | NP_001096036 |
| UniProt ID | A6NKN8 |
| ◆ Recombinant Proteins | ||
| PCP4L1-7507Z | Recombinant Zebrafish PCP4L1 | +Inquiry |
| PCP4L1-2456H | Recombinant human PCP4L1, His-tagged | +Inquiry |
| PCP4L1-12512M | Recombinant Mouse PCP4L1 Protein | +Inquiry |
| PCP4L1-6561M | Recombinant Mouse PCP4L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCP4L1-3651H | Recombinant Human PCP4L1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCP4L1 Products
Required fields are marked with *
My Review for All PCP4L1 Products
Required fields are marked with *
