Recombinant Human PCSK4, GST-tagged
Cat.No. : | PCSK4-85H |
Product Overview : | Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor II. |
Molecular Mass : | 52.36 kDa |
AA Sequence : | MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTG PQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGS PRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLS RARATPTKPQVWLPAGT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PCSK4 proprotein convertase subtilisin/kexin type 4 [ Homo sapiens(human) ] |
Official Symbol | PCSK4 |
Synonyms | PCSK4; PC4; SPC5; proprotein convertase subtilisin/kexin type 4 |
Gene ID | 54760 |
mRNA Refseq | NM_017573 |
Protein Refseq | NP_060043 |
MIM | 600487 |
UniProt ID | Q6UW60 |
Chromosome Location | 19p13.3 |
Function | serine-type endopeptidase activity |
◆ Recombinant Proteins | ||
PCSK4-85H | Recombinant Human PCSK4, GST-tagged | +Inquiry |
PCSK4-3968R | Recombinant Rat PCSK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK4-12516M | Recombinant Mouse PCSK4 Protein | +Inquiry |
RFL31644HF | Recombinant Full Length Human Proprotein Convertase Subtilisin/Kexin Type 4(Pcsk4) Protein, His-Tagged | +Inquiry |
PCSK4-4308R | Recombinant Rat PCSK4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK4-1317HCL | Recombinant Human PCSK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCSK4 Products
Required fields are marked with *
My Review for All PCSK4 Products
Required fields are marked with *