Recombinant Human PCSK4, GST-tagged

• Cat.No.: PCSK4-85H
• Product Overview: Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor II.
• Molecular Mass: 52.36 kDa
• AA Sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTG PQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGS PRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLS RARATPTKPQVWLPAGT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PCSK4 proprotein convertase subtilisin/kexin type 4 [ Homo sapiens(human) ]
• Official Symbol: PCSK4
• Synonyms: PCSK4; PC4; SPC5; proprotein convertase subtilisin/kexin type 4
• Gene ID: 54760
• mRNA Refseq: NM_017573
• Protein Refseq: NP_060043
• MIM: 600487
• UniProt ID: Q6UW60
• Chromosome Location: 19p13.3
• Function: serine-type endopeptidase activity