Recombinant Human PCSK4, GST-tagged
| Cat.No. : | PCSK4-85H |
| Product Overview : | Human PCSK4 full-length ORF ( AAH36354, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor II. |
| Molecular Mass : | 52.36 kDa |
| AA Sequence : | MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTG PQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGS PRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLS RARATPTKPQVWLPAGT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PCSK4 proprotein convertase subtilisin/kexin type 4 [ Homo sapiens(human) ] |
| Official Symbol | PCSK4 |
| Synonyms | PCSK4; PC4; SPC5; proprotein convertase subtilisin/kexin type 4 |
| Gene ID | 54760 |
| mRNA Refseq | NM_017573 |
| Protein Refseq | NP_060043 |
| MIM | 600487 |
| UniProt ID | Q6UW60 |
| Chromosome Location | 19p13.3 |
| Function | serine-type endopeptidase activity |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCSK4 Products
Required fields are marked with *
My Review for All PCSK4 Products
Required fields are marked with *
