Recombinant Human PCSK5 protein, GST-tagged
| Cat.No. : | PCSK5-30549TH |
| Product Overview : | Recombinant Human PCSK5(804 a.a. - 913 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 804-913 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDATE ESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PCSK5 proprotein convertase subtilisin/kexin type 5 [ Homo sapiens ] |
| Official Symbol | PCSK5 |
| Synonyms | PCSK5; proprotein convertase subtilisin/kexin type 5; PC5; PC6; SPC6; hPC6; protease PC6; prohormone convertase 5; proprotein convertase 6; subtilisin/kexin-like protease PC5; PC6A; FLJ11149; FLJ16215; |
| Gene ID | 5125 |
| mRNA Refseq | NM_006200 |
| Protein Refseq | NP_006191 |
| MIM | 600488 |
| UniProt ID | Q92824 |
| Chromosome Location | 9q21.3 |
| Pathway | NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signalling by NGF, organism-specific biosystem; |
| Function | peptidase activity; peptide binding; serine-type endopeptidase activity; serine-type endopeptidase activity; serine-type endopeptidase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCSK5 Products
Required fields are marked with *
My Review for All PCSK5 Products
Required fields are marked with *



