Recombinant Human PCSK5 protein, GST-tagged
Cat.No. : | PCSK5-30549TH |
Product Overview : | Recombinant Human PCSK5(804 a.a. - 913 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 804-913 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDATE ESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PCSK5 proprotein convertase subtilisin/kexin type 5 [ Homo sapiens ] |
Official Symbol | PCSK5 |
Synonyms | PCSK5; proprotein convertase subtilisin/kexin type 5; PC5; PC6; SPC6; hPC6; protease PC6; prohormone convertase 5; proprotein convertase 6; subtilisin/kexin-like protease PC5; PC6A; FLJ11149; FLJ16215; |
Gene ID | 5125 |
mRNA Refseq | NM_006200 |
Protein Refseq | NP_006191 |
MIM | 600488 |
UniProt ID | Q92824 |
Chromosome Location | 9q21.3 |
Pathway | NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signalling by NGF, organism-specific biosystem; |
Function | peptidase activity; peptide binding; serine-type endopeptidase activity; serine-type endopeptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PCSK5-711M | Recombinant Mouse PCSK5 Protein (117-452 aa), His-SUMO-tagged | +Inquiry |
PCSK5-1480M | Recombinant Mouse PCSK5 Protein (117-452 aa), His-tagged | +Inquiry |
PCSK5-4823H | Recombinant Human PCSK5 Protein (Asp115-Met454), N-His tagged | +Inquiry |
PCSK5-121H | Recombinant Human PCSK5, GST-tagged | +Inquiry |
PCSK5-122H | Recombinant Human PCSK5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK5-3370HCL | Recombinant Human PCSK5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCSK5 Products
Required fields are marked with *
My Review for All PCSK5 Products
Required fields are marked with *
0
Inquiry Basket