Recombinant Human PCSK6
Cat.No. : | PCSK6-30177TH |
Product Overview : | Recombinant fragment corresponding to amino acids 860-969 of Human PACE4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in pla |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCR RCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD ETFCEMVKSNRLCERKLFIQFCCRTCLLAG |
Sequence Similarities : | Belongs to the peptidase S8 family.Contains 1 homo B/P domain.Contains 1 PLAC domain. |
Gene Name : | PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ] |
Official Symbol : | PCSK6 |
Synonyms : | PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4; |
Gene ID : | 5046 |
mRNA Refseq : | NM_002570 |
Protein Refseq : | NP_002561 |
MIM : | 167405 |
Uniprot ID : | P29122 |
Chromosome Location : | 15q26 |
Pathway : | Developmental Biology, organism-specific biosystem; NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; Signalling by NGF, organism-specific biosystem; |
Function : | endopeptidase activity; eukaryotic cell surface binding; heparin binding; nerve growth factor binding; peptidase activity; |
Products Types
◆ Recombinant Protein | ||
PCSK6-3969R | Recombinant Rat PCSK6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK6-3303H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
PCSK6-3241H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
PCSK6-4309R | Recombinant Rat PCSK6 Protein | +Inquiry |
PCSK6-3302H | Recombinant Human PCSK6 protein, His-SUMO-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Ask a Question for All PCSK6 Products
Required fields are marked with *
My Review for All PCSK6 Products
Required fields are marked with *
0
Inquiry Basket