Recombinant Human PCSK6

Cat.No. : PCSK6-30177TH
Product Overview : Recombinant fragment corresponding to amino acids 860-969 of Human PACE4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in pla
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCR RCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD ETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Sequence Similarities : Belongs to the peptidase S8 family.Contains 1 homo B/P domain.Contains 1 PLAC domain.
Gene Name : PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ]
Official Symbol : PCSK6
Synonyms : PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4;
Gene ID : 5046
mRNA Refseq : NM_002570
Protein Refseq : NP_002561
MIM : 167405
Uniprot ID : P29122
Chromosome Location : 15q26
Pathway : Developmental Biology, organism-specific biosystem; NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; Signalling by NGF, organism-specific biosystem;
Function : endopeptidase activity; eukaryotic cell surface binding; heparin binding; nerve growth factor binding; peptidase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PCSK6 Products

Required fields are marked with *

My Review for All PCSK6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

Stay Updated on the
Latest Bioscience Trends

Copyright © 2023 Creative BioMart. All Rights Reserved.

Terms and Conditions        Privacy Policy