Recombinant Human PCSK6
Cat.No. : | PCSK6-30177TH |
Product Overview : | Recombinant fragment corresponding to amino acids 860-969 of Human PACE4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in pla |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCR RCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD ETFCEMVKSNRLCERKLFIQFCCRTCLLAG |
Sequence Similarities : | Belongs to the peptidase S8 family.Contains 1 homo B/P domain.Contains 1 PLAC domain. |
Gene Name | PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ] |
Official Symbol | PCSK6 |
Synonyms | PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4; |
Gene ID | 5046 |
mRNA Refseq | NM_002570 |
Protein Refseq | NP_002561 |
MIM | 167405 |
Uniprot ID | P29122 |
Chromosome Location | 15q26 |
Pathway | Developmental Biology, organism-specific biosystem; NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; Signalling by NGF, organism-specific biosystem; |
Function | endopeptidase activity; eukaryotic cell surface binding; heparin binding; nerve growth factor binding; peptidase activity; |
◆ Recombinant Proteins | ||
PCSK6-3969R | Recombinant Rat PCSK6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK6-6332H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
PCSK6-3303H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
PCSK6-30177TH | Recombinant Human PCSK6 | +Inquiry |
PCSK6-3241H | Recombinant Human PCSK6 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCSK6 Products
Required fields are marked with *
My Review for All PCSK6 Products
Required fields are marked with *