Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at Attend ADLM 2024 | July 28 - August 1, 2024

Recombinant Human PCSK6

Cat.No. : PCSK6-30177TH
Product Overview : Recombinant fragment corresponding to amino acids 860-969 of Human PACE4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in pla
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCR RCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD ETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Sequence Similarities : Belongs to the peptidase S8 family.Contains 1 homo B/P domain.Contains 1 PLAC domain.
Tag : Non
Gene Name : PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ]
Official Symbol : PCSK6
Synonyms : PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4;
Gene ID : 5046
mRNA Refseq : NM_002570
Protein Refseq : NP_002561
MIM : 167405
Uniprot ID : P29122
Chromosome Location : 15q26
Pathway : Developmental Biology, organism-specific biosystem; NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; Signalling by NGF, organism-specific biosystem;
Function : endopeptidase activity; eukaryotic cell surface binding; heparin binding; nerve growth factor binding; peptidase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
03/20/2019

    Outstanding service. High-quality protein analysis.

    01/10/2019

      Top-notch support. Instrumental in our research achievements.

      03/26/2018

        Exceptional accuracy. Accelerates our research progress.

        Q&As (7)

        Ask a question
        How does PCSK6 influence the activation of growth factors and hormones? 10/15/2022

        It activates growth factors and hormones, influencing cell growth and differentiation.

        What is the impact of altered PCSK6 activity in diseases like cancer? 08/28/2022

        Altered PCSK6 activity is associated with cancer progression, impacting cell growth.

        What role does PCSK6 play in developmental processes and organogenesis? 08/02/2021

        PCSK6 is key in development, affecting organ formation and body patterning.

        What is the primary function of PCSK6 in protein processing and regulation? 03/15/2021

        PCSK6 activates precursor proteins into their active forms, essential for protein regulation.

        How do genetic variations in PCSK6 affect its enzymatic activity and contribute to developmental disorders? 10/23/2020

        Mutations in PCSK6 can disrupt protein processing, leading to developmental disorders.

        How does PCSK6 interact with other proteases and signaling pathways in the cell? 05/07/2018

        PCSK6 cooperates with other proteases, playing a role in various cellular pathways.

        What potential therapeutic applications could arise from modulating PCSK6 activity in various diseases? 12/29/2017

        Targeting PCSK6 could be therapeutic in conditions involving abnormal protein activation.

        Ask a Question for All PCSK6 Products

        Required fields are marked with *

        My Review for All PCSK6 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends