Recombinant Human PCSK6

Cat.No. : PCSK6-30177TH
Product Overview : Recombinant fragment corresponding to amino acids 860-969 of Human PACE4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in pla
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCR RCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD ETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Sequence Similarities : Belongs to the peptidase S8 family.Contains 1 homo B/P domain.Contains 1 PLAC domain.
Gene Name PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ]
Official Symbol PCSK6
Synonyms PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4;
Gene ID 5046
mRNA Refseq NM_002570
Protein Refseq NP_002561
MIM 167405
Uniprot ID P29122
Chromosome Location 15q26
Pathway Developmental Biology, organism-specific biosystem; NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; Signalling by NGF, organism-specific biosystem;
Function endopeptidase activity; eukaryotic cell surface binding; heparin binding; nerve growth factor binding; peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCSK6 Products

Required fields are marked with *

My Review for All PCSK6 Products

Required fields are marked with *

0
cart-icon