Recombinant Human PCSK7, GST-tagged

Cat.No. : PCSK7-134H
Product Overview : Human PCSK7 full-length ORF ( AAH06357.1, 1 a.a. - 591 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease. It is structurally related to its family members, PACE and PACE4. This protein is concentrated in the trans-Golgi network, associated with the membranes, and is not secreted. It can process proalbumin and is thought to be responsible for the activation of HIV envelope glycoproteins gp160 and gp140. This gene has been implicated in the transcriptional regulation of housekeeping genes. Multiple alternatively spliced transcripts are described for this gene but their full length nature is not yet known. Downstream of this gene''''s map location at 11q23-q24, nucleotides that match part of this gene''''s 3'''' end are duplicated and inverted. A translocation breakpoint associated with lymphoma occurs between this gene and its inverted counterpart.
Molecular Mass : 90.75 kDa
AA Sequence : MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLESLEGDGEEETLEQQAD ALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAKRSVHFNDPKY PQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENG NHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMPFYAEECASMLAVTF SGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALMLQVRPCLTWRDVQHIIVFTATRYEDRRAEWV TNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVSPVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTL EHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPRSMDSWLCVECSRHQGQTKAVRECHEWKIPAR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PCSK7 proprotein convertase subtilisin/kexin type 7 [ Homo sapiens(human) ]
Official Symbol PCSK7
Synonyms PCSK7; LPC; PC7; PC8; SPC7; proprotein convertase subtilisin/kexin type 7; hPC8; prohormone convertase 7; proprotein convertase 7; proprotein convertase 8; prohormone convertase PC7; proprotein convertase PC7; lymphoma proprotein convertase; subtilisin/kexin-like protease PC7; EC 3.4.21.-
Gene ID 9159
mRNA Refseq NM_004716
Protein Refseq NP_004707
MIM 604872
UniProt ID Q16549
Chromosome Location 11q23-q24
Function serine-type endopeptidase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCSK7 Products

Required fields are marked with *

My Review for All PCSK7 Products

Required fields are marked with *

0
cart-icon
0
compare icon