Recombinant Human PCYOX1L protein, His-tagged
| Cat.No. : | PCYOX1L-4533H |
| Product Overview : | Recombinant Human PCYOX1L protein(305-418 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 305-418 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | ASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTAEWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDKIDQKDLMHKVKTEL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PCYOX1L prenylcysteine oxidase 1 like [ Homo sapiens (human) ] |
| Official Symbol | PCYOX1L |
| Synonyms | PCYOX1L; prenylcysteine oxidase 1 like; prenylcysteine oxidase-like |
| Gene ID | 78991 |
| mRNA Refseq | NM_024028 |
| Protein Refseq | NP_076933 |
| UniProt ID | Q8NBM8 |
| ◆ Recombinant Proteins | ||
| PCYOX1L-3153R | Recombinant Rhesus Macaque PCYOX1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCYOX1L-6568M | Recombinant Mouse PCYOX1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCYOX1L-1712H | Recombinant Human PCYOX1L | +Inquiry |
| PCYOX1L-3811H | Recombinant Human PCYOX1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| PCYOX1L-4533H | Recombinant Human PCYOX1L protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCYOX1L-1318HCL | Recombinant Human PCYOX1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCYOX1L Products
Required fields are marked with *
My Review for All PCYOX1L Products
Required fields are marked with *
