Recombinant Human PDAP1, His-tagged
Cat.No. : | PDAP1-29488TH |
Product Overview : | Recombinant full length Human PDAP1 with an C terminal His tag; 189 amino acids including tag, predicted MWt 21.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 181 amino acids |
Description : | The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. |
Conjugation : | HIS |
Molecular Weight : | 21.700kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 0.1mM PMSF, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNKLEHHHHHH |
Gene Name | PDAP1 PDGFA associated protein 1 [ Homo sapiens ] |
Official Symbol | PDAP1 |
Synonyms | PDAP1; PDGFA associated protein 1; 28 kDa heat- and acid-stable phosphoprotein; HASPP28; PAP; PAP1; PDGF associated protein; |
Gene ID | 11333 |
mRNA Refseq | NM_014891 |
Protein Refseq | NP_055706 |
MIM | 607075 |
Uniprot ID | Q13442 |
Chromosome Location | 7q |
◆ Recombinant Proteins | ||
Pdap1-4727M | Recombinant Mouse Pdap1 Protein, Myc/DDK-tagged | +Inquiry |
PDAP1-4317R | Recombinant Rat PDAP1 Protein | +Inquiry |
PDAP1-29488TH | Recombinant Human PDAP1, His-tagged | +Inquiry |
PDAP1-3977R | Recombinant Rat PDAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDAP1-3337R | Recombinant Rhesus monkey PDAP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDAP1-3364HCL | Recombinant Human PDAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDAP1 Products
Required fields are marked with *
My Review for All PDAP1 Products
Required fields are marked with *