Recombinant Human PDCD1
Cat.No. : | PDCD1-29487TH |
Product Overview : | Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV |
Sequence Similarities : | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | PDCD1 programmed cell death 1 [ Homo sapiens ] |
Official Symbol | PDCD1 |
Synonyms | PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1; |
Gene ID | 5133 |
mRNA Refseq | NM_005018 |
Protein Refseq | NP_005009 |
MIM | 600244 |
Uniprot ID | Q15116 |
Chromosome Location | 2q37.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | protein binding; protein tyrosine phosphatase activity; signal transducer activity; |
◆ Recombinant Proteins | ||
Pdcd1-560RAF555 | Recombinant Rat Pdcd1 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Pdcd1-2303MAF488 | Recombinant Mouse Pdcd1 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PDCD1-188HAF555 | Recombinant Human PDCD1 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
PDCD1-1221RAF555 | Recombinant Monkey PDCD1 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
PDCD1-700M | Recombinant Mouse PDCD1 Protein, IgG2a Fc-tagged | +Inquiry |
◆ Native Proteins | ||
PDCD1-76H | Active Recombinant Human PDCD1 Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD1-001RCL | Recombinant Rat PDCD1 cell lysate | +Inquiry |
PDCD1-2873HCL | Recombinant Human PDCD1 cell lysate | +Inquiry |
PDCD1-2628MCL | Recombinant Mouse PDCD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD1 Products
Required fields are marked with *
My Review for All PDCD1 Products
Required fields are marked with *