Recombinant Human PDCD1
| Cat.No. : | PDCD1-29487TH |
| Product Overview : | Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV |
| Sequence Similarities : | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Gene Name | PDCD1 programmed cell death 1 [ Homo sapiens ] |
| Official Symbol | PDCD1 |
| Synonyms | PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1; |
| Gene ID | 5133 |
| mRNA Refseq | NM_005018 |
| Protein Refseq | NP_005009 |
| MIM | 600244 |
| Uniprot ID | Q15116 |
| Chromosome Location | 2q37.3 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
| Function | protein binding; protein tyrosine phosphatase activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| PDCD1-1222RAF488 | Active Recombinant Monkey PDCD1 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| Pdcd1-560RF | Recombinant Rat Pdcd1 Protein, hFc-tagged, FITC conjugated | +Inquiry |
| Pdcd1-160M | Active Recombinant Mouse Pdcd1 protein(Met1-Gln167), hFc-tagged | +Inquiry |
| PDCD1-189HP | Recombinant Human PDCD1 protein, Fc-tagged, R-PE labeled | +Inquiry |
| PDCD1-032HP | Recombinant Human PDCD1 protein, HIgG1 Fc-tagged, R-PE labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD1-2873HCL | Recombinant Human PDCD1 cell lysate | +Inquiry |
| PDCD1-2628MCL | Recombinant Mouse PDCD1 cell lysate | +Inquiry |
| PDCD1-001RCL | Recombinant Rat PDCD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD1 Products
Required fields are marked with *
My Review for All PDCD1 Products
Required fields are marked with *
