Recombinant Human PDCD1

• Cat.No.: PDCD1-29487TH
• Product Overview: Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag.

Specification

• Description: This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
• Sequence Similarities: Contains 1 Ig-like V-type (immunoglobulin-like) domain.
• Tag: Non

Gene Information

• Gene Name: PDCD1 programmed cell death 1 [ Homo sapiens ]
• Official Symbol: PDCD1
• Synonyms: PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1
• Gene ID: 5133
• mRNA Refseq: NM_005018
• Protein Refseq: NP_005009
• MIM: 600244
• Uniprot ID: Q15116
• Chromosome Location: 2q37.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: protein binding; protein tyrosine phosphatase activity; signal transducer activity

Reviews

06/06/2021

Timely antibody validation, a valuable asset for our laboratory.

02/12/2021

Precise protein quantification, fundamental for maintaining data accuracy.

06/20/2019

Dependable peptide synthesis, accelerates our peptide-based projects effectively.

Q&As

What are the mechanisms by which PDCD1 modulates the immune response to viral infections?

PDCD1 modulates responses to viral infections, affecting T cell function and viral clearance.

What are the mechanisms by which PDCD1 modulates the immune response to viral infections?

PDCD1 modulates responses to viral infections, affecting T cell function and viral clearance.

What role does PDCD1 play in the development of immune tolerance?

PDCD1 helps develop immune tolerance, preventing overactive immune responses.

How does PDCD1 influence the balance between immune activation and autoimmunity?

PDCD1 maintains a balance between immune response and autoimmunity, preventing self-reactivity.

How does PDCD1 contribute to the exhaustion of T cells in chronic infections and cancer?

PDCD1 contributes to T cell exhaustion in chronic diseases and cancers, reducing immune efficacy.

How does PDCD1 influence the balance between immune activation and autoimmunity?

PDCD1 maintains a balance between immune response and autoimmunity, preventing self-reactivity.

What is the impact of PDCD1 on the effectiveness of immunotherapy in treating cancers?

PDCD1's role in immunotherapy is pivotal, as blocking PD-1 enhances anti-tumor responses.

How does PDCD1 contribute to the exhaustion of T cells in chronic infections and cancer?

PDCD1 contributes to T cell exhaustion in chronic diseases and cancers, reducing immune efficacy.

How does PDCD1 (PD-1) regulate immune checkpoint pathways in T cells?

PDCD1 regulates T cell activity by inhibiting immune responses, crucial in immune checkpoints.

What is the impact of PDCD1 on the effectiveness of immunotherapy in treating cancers?

PDCD1's role in immunotherapy is pivotal, as blocking PD-1 enhances anti-tumor responses.

What role does PDCD1 play in the development of immune tolerance?

PDCD1 helps develop immune tolerance, preventing overactive immune responses.

How do alterations in PDCD1 expression or signaling affect autoimmune disease progression?

Changes in PDCD1 signaling impact autoimmune disease progression, influencing immune system activity.

How does PDCD1 (PD-1) regulate immune checkpoint pathways in T cells?

PDCD1 regulates T cell activity by inhibiting immune responses, crucial in immune checkpoints.

How do alterations in PDCD1 expression or signaling affect autoimmune disease progression?

Changes in PDCD1 signaling impact autoimmune disease progression, influencing immune system activity.