Recombinant Human PDCD1 protein, His-tagged

Cat.No. : PDCD1-472H
Product Overview : Recombinant Human PDCD1(1 - 288 aa) fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1 - 288 aa
Description : This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/c background developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases.
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Molecular Mass : 38 kDa
AA Sequence : MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQ TDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGE LDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
Purity : > 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name PDCD1 programmed cell death 1 [ Homo sapiens ]
Official Symbol PDCD1
Synonyms PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1; protein PD-1; PD-1; SLEB2; hPD-1; hPD-l;
Gene ID 5133
mRNA Refseq NM_005018
Protein Refseq NP_005009
MIM 600244
UniProt ID Q15116
Chromosome Location 2q37.3
Pathway Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem; T cell receptor signaling pathway, organism-specific biosystem;
Function protein binding; protein tyrosine phosphatase activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDCD1 Products

Required fields are marked with *

My Review for All PDCD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon