| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1 - 288 aa |
| Description : |
This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/c background developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases. |
| Form : |
Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
| Molecular Mass : |
38 kDa |
| AA Sequence : |
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQ TDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGE LDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL |
| Purity : |
> 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : |
Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder. |
| Reconstitution : |
Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Shipping : |
The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
