Recombinant Human PDCD10 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PDCD10-2026H |
| Product Overview : | PDCD10 MS Standard C13 and N15-labeled recombinant protein (NP_009148) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Molecular Mass : | 24.7 kDa |
| AA Sequence : | MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PDCD10 programmed cell death 10 [ Homo sapiens (human) ] |
| Official Symbol | PDCD10 |
| Synonyms | PDCD10; programmed cell death 10; CCM3, cerebral cavernous malformations 3; programmed cell death protein 10; TFAR15; apoptosis-related protein 15; TF-1 cell apoptosis-related protein 15; cerebral cavernous malformations 3 protein; CCM3; MGC1212; MGC24477; |
| Gene ID | 11235 |
| mRNA Refseq | NM_007217 |
| Protein Refseq | NP_009148 |
| MIM | 609118 |
| UniProt ID | Q9BUL8 |
| ◆ Recombinant Proteins | ||
| PDCD10-1692C | Recombinant Chicken PDCD10 | +Inquiry |
| PDCD10-10H | Recombinant Human PDCD10S1 protein | +Inquiry |
| PDCD10-3339R | Recombinant Rhesus monkey PDCD10 Protein, His-tagged | +Inquiry |
| Pdcd10-4731M | Recombinant Mouse Pdcd10 Protein, Myc/DDK-tagged | +Inquiry |
| PDCD10-2026H | Recombinant Human PDCD10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD10-3363HCL | Recombinant Human PDCD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD10 Products
Required fields are marked with *
My Review for All PDCD10 Products
Required fields are marked with *
