"PDCD4" Related Products

Expand
Expand
Expand

Recombinant Human PDCD4 Protein, His-tagged

Cat.No.: PDCD4-484H
Product Overview: Recombinant Human PDCD4, transcript variant 1, fused with His tag at C-terminal was expressed in E. coli.
Description: THis gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants
Source: E. coli
Tag : His
Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass: 17kD
AA Sequence: MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: PDCD4 programmed cell death 4 (neoplastic transformation inhibitor) [ Homo sapiens ]
Official Symbol: PDCD4
Synonyms: PDCD4; programmed cell death 4 (neoplastic transformation inhibitor); programmed cell death protein 4; H731; nuclear antigen H731; protein 197/15a; neoplastic transformation inhibitor protein; MGC33046; MGC33047;
Gene ID: 27250
mRNA Refseq: NM_001199492
Protein Refseq: NP_001186421
MIM: 608610
UniProt ID: Q53EL6

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.