Recombinant Human PDCD4 Protein, His-tagged
| Cat.No. : | PDCD4-484H |
| Product Overview : | Recombinant Human PDCD4, transcript variant 1, fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | THis gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : | 17kD |
| AA Sequence : | MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | PDCD4 programmed cell death 4 (neoplastic transformation inhibitor) [ Homo sapiens ] |
| Official Symbol | PDCD4 |
| Synonyms | PDCD4; programmed cell death 4 (neoplastic transformation inhibitor); programmed cell death protein 4; H731; nuclear antigen H731; protein 197/15a; neoplastic transformation inhibitor protein; MGC33046; MGC33047; |
| Gene ID | 27250 |
| mRNA Refseq | NM_001199492 |
| Protein Refseq | NP_001186421 |
| MIM | 608610 |
| UniProt ID | Q53EL6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD4 Products
Required fields are marked with *
My Review for All PDCD4 Products
Required fields are marked with *



