Recombinant Human PDCD4 Protein, His-tagged
Cat.No. : | PDCD4-484H |
Product Overview : | Recombinant Human PDCD4, transcript variant 1, fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | THis gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 17kD |
AA Sequence : | MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | PDCD4 programmed cell death 4 (neoplastic transformation inhibitor) [ Homo sapiens ] |
Official Symbol | PDCD4 |
Synonyms | PDCD4; programmed cell death 4 (neoplastic transformation inhibitor); programmed cell death protein 4; H731; nuclear antigen H731; protein 197/15a; neoplastic transformation inhibitor protein; MGC33046; MGC33047; |
Gene ID | 27250 |
mRNA Refseq | NM_001199492 |
Protein Refseq | NP_001186421 |
MIM | 608610 |
UniProt ID | Q53EL6 |
◆ Recombinant Proteins | ||
PDCD4-365HF | Active Recombinant Full Length Human PDCD4 Protein | +Inquiry |
PDCD4-3341R | Recombinant Rhesus monkey PDCD4 Protein, His-tagged | +Inquiry |
PDCD4-484H | Recombinant Human PDCD4 Protein, His-tagged | +Inquiry |
PDCD4-12535M | Recombinant Mouse PDCD4 Protein | +Inquiry |
PDCD4-1593H | Recombinant Human PDCD4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBT-56410RH | Rabbit Anti-Human PDCD4 Polyclonal Antibody | +Inquiry |
PDCD4-1320HCL | Recombinant Human PDCD4 cell lysate | +Inquiry |
CPBT-56409RH | Rabbit Anti-Human PDCD4 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDCD4 Products
Required fields are marked with *
My Review for All PDCD4 Products
Required fields are marked with *
0
Inquiry Basket