Recombinant Human PDCD4 Protein, His-tagged

Cat.No. : PDCD4-484H
Product Overview : Recombinant Human PDCD4, transcript variant 1, fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : THis gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 17kD
AA Sequence : MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name PDCD4 programmed cell death 4 (neoplastic transformation inhibitor) [ Homo sapiens ]
Official Symbol PDCD4
Synonyms PDCD4; programmed cell death 4 (neoplastic transformation inhibitor); programmed cell death protein 4; H731; nuclear antigen H731; protein 197/15a; neoplastic transformation inhibitor protein; MGC33046; MGC33047;
Gene ID 27250
mRNA Refseq NM_001199492
Protein Refseq NP_001186421
MIM 608610
UniProt ID Q53EL6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDCD4 Products

Required fields are marked with *

My Review for All PDCD4 Products

Required fields are marked with *

0
cart-icon
0
compare icon