Recombinant Human PDCD4 Protein, His-tagged

• Cat.No.: PDCD4-484H
• Product Overview: Recombinant Human PDCD4, transcript variant 1, fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: THis gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 17kD
• AA Sequence: MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: PDCD4 programmed cell death 4 (neoplastic transformation inhibitor) [ Homo sapiens ]
• Official Symbol: PDCD4
• Synonyms: PDCD4; programmed cell death 4 (neoplastic transformation inhibitor); programmed cell death protein 4; H731; nuclear antigen H731; protein 197/15a; neoplastic transformation inhibitor protein; MGC33046; MGC33047
• Gene ID: 27250
• mRNA Refseq: NM_001199492
• Protein Refseq: NP_001186421
• MIM: 608610
• UniProt ID: Q53EL6