Recombinant Human PDE3B protein, His-tagged
Cat.No. : | PDE3B-3492H |
Product Overview : | Recombinant Human PDE3B protein(321-670 aa), fused to His tag, was expressed in E. coli. |
Availability | October 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 321-670 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDE3B phosphodiesterase 3B, cGMP-inhibited [ Homo sapiens ] |
Official Symbol | PDE3B |
Synonyms | PDE3B; phosphodiesterase 3B, cGMP-inhibited; cGMP-inhibited 3,5-cyclic phosphodiesterase B; HcGIP1; CGIP1; CGI-PDE B; cyclic nucleotide phosphodiesterase; cyclic GMP-inhibited phosphodiesterase B; cGIPDE1; |
Gene ID | 5140 |
mRNA Refseq | NM_000922 |
Protein Refseq | NP_000913 |
MIM | 602047 |
UniProt ID | Q13370 |
◆ Recombinant Proteins | ||
PDE3B-1526H | Active Recombinant Human PDE3B, GST-tagged | +Inquiry |
PDE3B-742H | Recombinant Human PDE3B Protein, MYC/DDK-tagged | +Inquiry |
PDE3B-2849C | Recombinant Chicken PDE3B | +Inquiry |
PDE3B-3989R | Recombinant Rat PDE3B Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE3B-474H | Recombinant Human PDE3B, GST-tagged, Active | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE3B Products
Required fields are marked with *
My Review for All PDE3B Products
Required fields are marked with *