Recombinant Human PDE3B protein, His-tagged

Cat.No. : PDE3B-3492H
Product Overview : Recombinant Human PDE3B protein(321-670 aa), fused to His tag, was expressed in E. coli.
Availability September 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 321-670 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : CISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PDE3B phosphodiesterase 3B, cGMP-inhibited [ Homo sapiens ]
Official Symbol PDE3B
Synonyms PDE3B; phosphodiesterase 3B, cGMP-inhibited; cGMP-inhibited 3,5-cyclic phosphodiesterase B; HcGIP1; CGIP1; CGI-PDE B; cyclic nucleotide phosphodiesterase; cyclic GMP-inhibited phosphodiesterase B; cGIPDE1;
Gene ID 5140
mRNA Refseq NM_000922
Protein Refseq NP_000913
MIM 602047
UniProt ID Q13370

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDE3B Products

Required fields are marked with *

My Review for All PDE3B Products

Required fields are marked with *

0
cart-icon
0
compare icon