Recombinant Human PDE6A protein, GST-tagged
Cat.No. : | PDE6A-1879H |
Product Overview : | Recombinant Human PDE6A protein(1-90 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-90 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDE6A phosphodiesterase 6A, cGMP-specific, rod, alpha [ Homo sapiens ] |
Official Symbol | PDE6A |
Synonyms | PDE6A; phosphodiesterase 6A, cGMP-specific, rod, alpha; PDEA; rod cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha; PDE V-B1; GMP-PDE alpha; cGMP phosphodiesterase alpha subunit; rod photoreceptor cGMP phosphodiesterase alpha subunit; RP43; CGPR-A; |
Gene ID | 5145 |
mRNA Refseq | NM_000440 |
Protein Refseq | NP_000431 |
MIM | 180071 |
UniProt ID | P16499 |
◆ Recombinant Proteins | ||
PDE6A-1613H | Active Recombinant Human PDE6A, GST-tagged | +Inquiry |
PDE6A-352H | Recombinant Human PDE6A | +Inquiry |
PDE6A-1879H | Recombinant Human PDE6A protein, GST-tagged | +Inquiry |
PDE6A-1604H | Recombinant Human PDE6A, His-tagged | +Inquiry |
PDE6A-3167R | Recombinant Rhesus Macaque PDE6A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PDE6A-10HFL | Recombinant Full Length Human PDE6A Protein, His tagged | +Inquiry |
PDE6A-22HFL | Recombinant Full Length Human PDE6A Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE6A-3347HCL | Recombinant Human PDE6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE6A Products
Required fields are marked with *
My Review for All PDE6A Products
Required fields are marked with *