Recombinant Human PDE6A protein, GST-tagged

Cat.No. : PDE6A-1879H
Product Overview : Recombinant Human PDE6A protein(1-90 aa), fused to GST tag, was expressed in E. coli.
Availability July 29, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-90 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PDE6A phosphodiesterase 6A, cGMP-specific, rod, alpha [ Homo sapiens ]
Official Symbol PDE6A
Synonyms PDE6A; phosphodiesterase 6A, cGMP-specific, rod, alpha; PDEA; rod cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha; PDE V-B1; GMP-PDE alpha; cGMP phosphodiesterase alpha subunit; rod photoreceptor cGMP phosphodiesterase alpha subunit; RP43; CGPR-A;
Gene ID 5145
mRNA Refseq NM_000440
Protein Refseq NP_000431
MIM 180071
UniProt ID P16499

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDE6A Products

Required fields are marked with *

My Review for All PDE6A Products

Required fields are marked with *

0
cart-icon
0
compare icon