Recombinant Human PDGFRA protein(961-1040 aa), C-His-tagged
Cat.No. : | PDGFRA-2664H |
Product Overview : | Recombinant Human PDGFRA protein(P16234)(961-1040 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 961-1040 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRH |
Gene Name | PDGFRA platelet-derived growth factor receptor, alpha polypeptide [ Homo sapiens ] |
Official Symbol | PDGFRA |
Synonyms | PDGFRA; platelet-derived growth factor receptor, alpha polypeptide; platelet-derived growth factor receptor alpha; CD140a; PDGFR2; PDGFR-alpha; PDGF-R-alpha; CD140a antigen; PDGFRA/BCR fusion; CD140 antigen-like family member A; platelet-derived growth factor receptor 2; alpha-type platelet-derived growth factor receptor; rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein; CD140A; PDGFR-2; RHEPDGFRA; MGC74795; |
Gene ID | 5156 |
mRNA Refseq | NM_006206 |
Protein Refseq | NP_006197 |
MIM | 173490 |
UniProt ID | P16234 |
◆ Recombinant Proteins | ||
Pdgfra-52R | Recombinant Rat Pdgfra, His tagged | +Inquiry |
PDGFRA-12570M | Recombinant Mouse PDGFRA Protein | +Inquiry |
Pdgfra-385M | Recombinant Mouse Pdgfra, GST-tagged, Active | +Inquiry |
PDGFRA-7290H | Recombinant Human PDGFRA, His & GST tagged | +Inquiry |
PDGFRA-824HAF647 | Recombinant Human PDGFRA Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFRA-001HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
PDGFRA-824RCL | Recombinant Rat PDGFRA cell lysate | +Inquiry |
PDGFRA-2657HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFRA Products
Required fields are marked with *
My Review for All PDGFRA Products
Required fields are marked with *