Recombinant Human PDGFRA protein(961-1040 aa), C-His-tagged
| Cat.No. : | PDGFRA-2664H |
| Product Overview : | Recombinant Human PDGFRA protein(P16234)(961-1040 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 961-1040 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRH |
| Gene Name | PDGFRA platelet-derived growth factor receptor, alpha polypeptide [ Homo sapiens ] |
| Official Symbol | PDGFRA |
| Synonyms | PDGFRA; platelet-derived growth factor receptor, alpha polypeptide; platelet-derived growth factor receptor alpha; CD140a; PDGFR2; PDGFR-alpha; PDGF-R-alpha; CD140a antigen; PDGFRA/BCR fusion; CD140 antigen-like family member A; platelet-derived growth factor receptor 2; alpha-type platelet-derived growth factor receptor; rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein; CD140A; PDGFR-2; RHEPDGFRA; MGC74795; |
| Gene ID | 5156 |
| mRNA Refseq | NM_006206 |
| Protein Refseq | NP_006197 |
| MIM | 173490 |
| UniProt ID | P16234 |
| ◆ Recombinant Proteins | ||
| PDGFRA-1282R | Recombinant Rat PDGFRA protein(Met1-Glu523), hFc-tagged | +Inquiry |
| PDGFRA-1633H | Recombinant Human PDGFRA Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDGFRA-6767M | Recombinant Mouse PDGFRA Protein (Leu25-Glu524), C-His tagged | +Inquiry |
| Pdgfra-52R | Recombinant Rat Pdgfra, His tagged | +Inquiry |
| PDGFRA-824HAF488 | Recombinant Human PDGFRA Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFRA-001HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
| PDGFRA-2657HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
| PDGFRA-824RCL | Recombinant Rat PDGFRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFRA Products
Required fields are marked with *
My Review for All PDGFRA Products
Required fields are marked with *



