Recombinant Human PDGFRB protein, His-GST-tagged

• Cat.No.: PDGFRB-5633H
• Product Overview: Recombinant Human PDGFRB protein(P09619)(901-1106aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 901-1106aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL

Gene Information

• Gene Name: PDGFRB platelet-derived growth factor receptor, beta polypeptide [ Homo sapiens ]
• Official Symbol: PDGFRB
• Synonyms: PDGFRB; platelet-derived growth factor receptor, beta polypeptide; PDGFR; platelet-derived growth factor receptor beta; CD140b; JTK12; PDGFR1; PDGFR-beta; PDGF-R-beta; CD140 antigen-like family member B; platelet-derived growth factor receptor 1; beta-type platelet-derived growth factor receptor; CD140B; PDGFR-1
• Gene ID: 5159
• mRNA Refseq: NM_002609
• Protein Refseq: NP_002600
• MIM: 173410
• UniProt ID: P09619