Recombinant Human PDGFRB protein, His-GST-tagged

Cat.No. : PDGFRB-5633H
Product Overview : Recombinant Human PDGFRB protein(P09619)(901-1106aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 901-1106aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54.6 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL
Gene Name PDGFRB platelet-derived growth factor receptor, beta polypeptide [ Homo sapiens ]
Official Symbol PDGFRB
Synonyms PDGFRB; platelet-derived growth factor receptor, beta polypeptide; PDGFR; platelet-derived growth factor receptor beta; CD140b; JTK12; PDGFR1; PDGFR-beta; PDGF-R-beta; CD140 antigen-like family member B; platelet-derived growth factor receptor 1; beta-type platelet-derived growth factor receptor; CD140B; PDGFR-1;
Gene ID 5159
mRNA Refseq NM_002609
Protein Refseq NP_002600
MIM 173410
UniProt ID P09619

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFRB Products

Required fields are marked with *

My Review for All PDGFRB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon