Recombinant Human PDILT, His-tagged

Cat.No. : PDILT-171H
Product Overview : Recombinant Human Protein Disulfide-Isomerase-Like Protein of the Testis/PDILT produced by transfected human cells is a secreted protein with sequence (Ser21-Leu584) of Human PDILT fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-584 a.a.
Description : Protein Disulfide-Isomerase-Like Protein of the Testis (PDILT) is a protein that belongs to the protein disulfide isomerase family. Human PDILT is synthesized as a 584 amino acid precursor that contains an 20 amino acid signal sequence and a 564 amino acid mature chain. PDILT contains 1 thioredoxin domain lacks the conserved redox-active Cys at position 417 which is replaced by a Ser residue, suggesting that it lacks thioredoxin activity. PDILT is an enzyme in the endoplasmic reticulum in eukaryotes. It is not a disulfide-linked homodimer. The PDILT protein can interacts with ERO1L and CLGN. PDILT probable redox-inactive chaperone involved in spermatogenesis.
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0
AA Sequence : SPEVNAGVSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKA VEIMGKGKNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVESAALVVWLRR QISQKAFLFNSSEQVAEFVISRPLVIVGFFQDLEEEVAELFYDVIKDFPELTFGVITIGNVIGRF HVTLDSVLVFKKGKIVNRQKLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLL FVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDA RYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFV MFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVL YKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELEN MTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKVKEELVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name PDILT protein disulfide isomerase-like, testis expressed [ Homo sapiens ]
Official Symbol PDILT
Synonyms PDILT; protein disulfide isomerase-like, testis expressed; protein disulfide-isomerase-like protein of the testis; PDIA7; protein disulfide isomerase family A; member 7; protein disulfide isomerase like protein of the testis; protein disulfide isomerase family A, member 7; protein disulfide isomerase-like protein of the testis;
Gene ID 204474
mRNA Refseq NM_174924
Protein Refseq NP_777584
UniProt ID Q8N807
Chromosome Location 16p12.3
Function isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDILT Products

Required fields are marked with *

My Review for All PDILT Products

Required fields are marked with *

0
cart-icon
0
compare icon