Recombinant Human PDP2 Protein (67-529 aa), His-tagged
Cat.No. : | PDP2-1128H |
Product Overview : | Recombinant Human PDP2 Protein (67-529 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 67-529 aa |
Description : | Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 56.4 kDa |
AA Sequence : | STEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | PDP2 pyruvate dehyrogenase phosphatase catalytic subunit 2 [ Homo sapiens ] |
Official Symbol | PDP2 |
Synonyms | PDP2; KIAA1348; PPM2C2; PDPC 2; |
Gene ID | 57546 |
mRNA Refseq | NM_020786 |
Protein Refseq | NP_065837 |
UniProt ID | Q9P2J9 |
◆ Recombinant Proteins | ||
PDP2-3362R | Recombinant Rhesus monkey PDP2 Protein, His-tagged | +Inquiry |
PDP2-4356R | Recombinant Rat PDP2 Protein | +Inquiry |
PDP2-1715H | Recombinant Human PDP2 | +Inquiry |
PDP2-699H | Recombinant Human PDP2, His-tagged | +Inquiry |
Pdp2-4776M | Recombinant Mouse Pdp2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDP2-3323HCL | Recombinant Human PDP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDP2 Products
Required fields are marked with *
My Review for All PDP2 Products
Required fields are marked with *
0
Inquiry Basket