Recombinant Human PDS5B protein, GST-tagged
| Cat.No. : | PDS5B-301643H |
| Product Overview : | Recombinant Human PDS5B (1139-1310 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1139-Thr1310 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PDS5B PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | PDS5B |
| Synonyms | PDS5B; PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae); androgen induced proliferation inhibitor , APRIN; sister chromatid cohesion protein PDS5 homolog B; AS3; CG008; FLJ23236; KIAA0979; androgen-induced shutoff 3; androgen-induced proliferation inhibitor; androgen induced inhibitor of proliferation; androgen-induced prostate proliferative shutoff-associated protein AS3; APRIN; |
| Gene ID | 23047 |
| mRNA Refseq | NM_015032 |
| Protein Refseq | NP_055847 |
| MIM | 605333 |
| UniProt ID | Q9NTI5 |
| ◆ Recombinant Proteins | ||
| PDS5B-2053C | Recombinant Chicken PDS5B | +Inquiry |
| APRIN-728H | Recombinant Human APRIN protein, GST-tagged | +Inquiry |
| PDS5B-12598M | Recombinant Mouse PDS5B Protein | +Inquiry |
| PDS5B-6616M | Recombinant Mouse PDS5B Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDS5B-1629H | Recombinant Human PDS5B Protein(228-529 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDS5B-101HCL | Recombinant Human PDS5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDS5B Products
Required fields are marked with *
My Review for All PDS5B Products
Required fields are marked with *
