Recombinant Human PDS5B protein, GST-tagged

Cat.No. : PDS5B-301643H
Product Overview : Recombinant Human PDS5B (1139-1310 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1139-Thr1310
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name PDS5B PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae) [ Homo sapiens ]
Official Symbol PDS5B
Synonyms PDS5B; PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae); androgen induced proliferation inhibitor , APRIN; sister chromatid cohesion protein PDS5 homolog B; AS3; CG008; FLJ23236; KIAA0979; androgen-induced shutoff 3; androgen-induced proliferation inhibitor; androgen induced inhibitor of proliferation; androgen-induced prostate proliferative shutoff-associated protein AS3; APRIN;
Gene ID 23047
mRNA Refseq NM_015032
Protein Refseq NP_055847
MIM 605333
UniProt ID Q9NTI5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDS5B Products

Required fields are marked with *

My Review for All PDS5B Products

Required fields are marked with *

0
cart-icon