Recombinant Human PDSS2 protein, His-tagged
Cat.No. : | PDSS2-3388H |
Product Overview : | Recombinant Human PDSS2 protein(1 - 242 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 242 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDSS2 prenyl (decaprenyl) diphosphate synthase, subunit 2 [ Homo sapiens ] |
Official Symbol | PDSS2 |
Synonyms | PDSS2; prenyl (decaprenyl) diphosphate synthase, subunit 2; C6orf210, chromosome 6 open reading frame 210; decaprenyl-diphosphate synthase subunit 2; bA59I9.3; decaprenyl pyrophosphate synthase subunit 2; subunit 2 of decaprenyl diphosphate synthase; decaprenyl pyrophosphate synthetase subunit 2; all-trans-decaprenyl-diphosphate synthase subunit 2; DLP1; hDLP1; C6orf210; |
Gene ID | 57107 |
mRNA Refseq | NM_020381 |
Protein Refseq | NP_065114 |
MIM | 610564 |
UniProt ID | Q86YH6 |
◆ Recombinant Proteins | ||
Pdss2-4779M | Recombinant Mouse Pdss2 Protein, Myc/DDK-tagged | +Inquiry |
PDSS2-3182R | Recombinant Rhesus Macaque PDSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDSS2-4361R | Recombinant Rat PDSS2 Protein | +Inquiry |
PDSS2-4256H | Recombinant Human PDSS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDSS2-12600M | Recombinant Mouse PDSS2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDSS2-3319HCL | Recombinant Human PDSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDSS2 Products
Required fields are marked with *
My Review for All PDSS2 Products
Required fields are marked with *
0
Inquiry Basket