Recombinant Human PDSS2 protein, His-tagged

Cat.No. : PDSS2-3388H
Product Overview : Recombinant Human PDSS2 protein(1 - 242 aa), fused to His tag, was expressed in E. coli.
Availability May 28, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1 - 242 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDI
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PDSS2 prenyl (decaprenyl) diphosphate synthase, subunit 2 [ Homo sapiens ]
Official Symbol PDSS2
Synonyms PDSS2; prenyl (decaprenyl) diphosphate synthase, subunit 2; C6orf210, chromosome 6 open reading frame 210; decaprenyl-diphosphate synthase subunit 2; bA59I9.3; decaprenyl pyrophosphate synthase subunit 2; subunit 2 of decaprenyl diphosphate synthase; decaprenyl pyrophosphate synthetase subunit 2; all-trans-decaprenyl-diphosphate synthase subunit 2; DLP1; hDLP1; C6orf210;
Gene ID 57107
mRNA Refseq NM_020381
Protein Refseq NP_065114
MIM 610564
UniProt ID Q86YH6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDSS2 Products

Required fields are marked with *

My Review for All PDSS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon