Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PDX1

Cat.No. : PDX1-29672TH
Product Overview : Recombinant full length protein of Human PDX1 with proprietary tag; predicted MW 58.13 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).
Protein length : 283 amino acids
Molecular Weight : 58.130kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGR QPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVA HLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLE LEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR
Sequence Similarities : Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name : PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ]
Official Symbol : PDX1
Synonyms : PDX1; pancreatic and duodenal homeobox 1; insulin promoter factor 1, homeodomain transcription factor , IPF1; pancreas/duodenum homeobox protein 1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1;
Gene ID : 3651
mRNA Refseq : NM_000209
Protein Refseq : NP_000200
MIM : 600733
Uniprot ID : P52945
Chromosome Location : 13q12.1
Pathway : Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem;
Function : chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends