Recombinant Human PDZD11 protein, His-SUMO-tagged
| Cat.No. : | PDZD11-4503H |
| Product Overview : | Recombinant Human PDZD11 protein(Q5EBL8)(1-140aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-140aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.1 kDa |
| AA Sequence : | MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PDZD11 PDZ domain containing 11 [ Homo sapiens ] |
| Official Symbol | PDZD11 |
| Synonyms | PDZD11; PDZ domain containing 11; PDZK11; PDZ domain-containing protein 11; ATPase-interacting PDZ protein; PISP; AIPP1; |
| Gene ID | 51248 |
| mRNA Refseq | NM_016484 |
| Protein Refseq | NP_057568 |
| MIM | 300632 |
| UniProt ID | Q5EBL8 |
| ◆ Recombinant Proteins | ||
| PDZD11-3796H | Recombinant Human PDZD11 protein(Asp2-His140), His-tagged | +Inquiry |
| PDZD11-2784C | Recombinant Chicken PDZD11 | +Inquiry |
| PDZD11-7211H | Recombinant Human PDZ Domain Containing 11, His-tagged | +Inquiry |
| PDZD11-4503H | Recombinant Human PDZD11 protein, His-SUMO-tagged | +Inquiry |
| PDZD11-12206Z | Recombinant Zebrafish PDZD11 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDZD11-3315HCL | Recombinant Human PDZD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDZD11 Products
Required fields are marked with *
My Review for All PDZD11 Products
Required fields are marked with *
