Recombinant Human PECAM1 protein(631-700 aa), C-His-tagged
Cat.No. : | PECAM1-2665H |
Product Overview : | Recombinant Human PECAM1 protein(P16284)(631-700 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 631-700 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAES |
Gene Name | PECAM1 platelet/endothelial cell adhesion molecule 1 [ Homo sapiens ] |
Official Symbol | PECAM1 |
Synonyms | PECAM1; platelet/endothelial cell adhesion molecule 1; platelet/endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule; CD31; CD31 antigen; PECA1; GPIIA; PECAM-1; endoCAM; CD31/EndoCAM; FLJ34100; FLJ58394; |
Gene ID | 5175 |
mRNA Refseq | NM_000442 |
Protein Refseq | NP_000433 |
MIM | 173445 |
UniProt ID | P16284 |
◆ Recombinant Proteins | ||
PECAM1-04M | Recombinant Mouse PECAM1 Protein, His-tagged | +Inquiry |
PECAM1-647H | Recombinant Human PECAM1 protein, His-tagged | +Inquiry |
PECAM1-2629H | Active Recombinant Human PECAM1 protein, His-tagged | +Inquiry |
Pecam1-509M | Recombinant Mouse Pecam1 Protein, His-tagged | +Inquiry |
PECAM1-4262H | Recombinant Human Platelet/Endothelial Cell Adhesion Molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
PECAM1-2266MCL | Recombinant Mouse PECAM1 cell lysate | +Inquiry |
PECAM1-2798HCL | Recombinant Human PECAM1 cell lysate, His-tagged | +Inquiry |
PECAM1-3050HCL | Recombinant Human PECAM1 cell lysate, Fc-tagged | +Inquiry |
PECAM1-3049HCL | Recombinant Human PECAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PECAM1 Products
Required fields are marked with *
My Review for All PECAM1 Products
Required fields are marked with *
0
Inquiry Basket