Recombinant Human PECAM1 protein(631-700 aa), C-His-tagged
| Cat.No. : | PECAM1-2665H |
| Product Overview : | Recombinant Human PECAM1 protein(P16284)(631-700 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 631-700 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAES |
| Gene Name | PECAM1 platelet/endothelial cell adhesion molecule 1 [ Homo sapiens ] |
| Official Symbol | PECAM1 |
| Synonyms | PECAM1; platelet/endothelial cell adhesion molecule 1; platelet/endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule; CD31; CD31 antigen; PECA1; GPIIA; PECAM-1; endoCAM; CD31/EndoCAM; FLJ34100; FLJ58394; |
| Gene ID | 5175 |
| mRNA Refseq | NM_000442 |
| Protein Refseq | NP_000433 |
| MIM | 173445 |
| UniProt ID | P16284 |
| ◆ Recombinant Proteins | ||
| PECAM1-4029R | Recombinant Rat PECAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PECAM1-647H | Active Recombinant Human PECAM1 protein, His-tagged | +Inquiry |
| PECAM1-5845H | Recombinant Human PECAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PECAM1-59H | Recombinant Human PECAM1, Fc-Tagged | +Inquiry |
| Pecam1-1179R | Recombinant Rat Pecam1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PECAM1-2798HCL | Recombinant Human PECAM1 cell lysate, His-tagged | +Inquiry |
| PECAM1-3050HCL | Recombinant Human PECAM1 cell lysate, Fc-tagged | +Inquiry |
| PECAM1-2266MCL | Recombinant Mouse PECAM1 cell lysate | +Inquiry |
| PECAM1-3049HCL | Recombinant Human PECAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PECAM1 Products
Required fields are marked with *
My Review for All PECAM1 Products
Required fields are marked with *


