Recombinant Human PEDS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PEDS1-2819H
Product Overview : TMEM189 MS Standard C13 and N15-labeled recombinant protein (NP_954580) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants.
Molecular Mass : 31 kDa
AA Sequence : MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PEDS1 plasmanylethanolamine desaturase 1 [ Homo sapiens (human) ]
Official Symbol PEDS1
Synonyms PEDS1; plasmanylethanolamine desaturase 1; KUA; CarF; TMEM189; plasmanylethanolamine desaturase; transmembrane protein 189; EC 1.14.19.77
Gene ID 387521
mRNA Refseq NM_199129
Protein Refseq NP_954580
MIM 610994
UniProt ID A5PLL7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PEDS1 Products

Required fields are marked with *

My Review for All PEDS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon