Recombinant Human PEDS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PEDS1-2819H
• Product Overview: TMEM189 MS Standard C13 and N15-labeled recombinant protein (NP_954580) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Co-transcription of this gene and the neighboring downstream gene (ubiquitin-conjugating enzyme E2 variant 1) generates a rare read-through transcript, which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The protein encoded by this individual gene lacks a UEV1 domain but includes three transmembrane regions. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 31 kDa
• AA Sequence: MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PEDS1 plasmanylethanolamine desaturase 1 [ Homo sapiens (human) ]
• Official Symbol: PEDS1
• Synonyms: PEDS1; plasmanylethanolamine desaturase 1; KUA; CarF; TMEM189; plasmanylethanolamine desaturase; transmembrane protein 189; EC 1.14.19.77
• Gene ID: 387521
• mRNA Refseq: NM_199129
• Protein Refseq: NP_954580
• MIM: 610994
• UniProt ID: A5PLL7