Recombinant Human PELI2 protein, His-tagged

• Cat.No.: PELI2-1642H
• Product Overview: Recombinant Human PELI2 protein(281-420 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 281-420 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: RPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PELI2 pellino E3 ubiquitin protein ligase family member 2 [ Homo sapiens ]
• Official Symbol: PELI2
• Synonyms: PELI2; pellino E3 ubiquitin protein ligase family member 2; pellino (Drosophila) homolog 2 , pellino homolog 2 (Drosophila); E3 ubiquitin-protein ligase pellino homolog 2; pellino-2; pellino homolog 2; protein pellino homolog 2
• Gene ID: 57161
• mRNA Refseq: NM_021255
• Protein Refseq: NP_067078
• UniProt ID: Q9HAT8