Recombinant Human PELI2 protein, His-tagged
| Cat.No. : | PELI2-1642H |
| Product Overview : | Recombinant Human PELI2 protein(281-420 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | September 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 281-420 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | RPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PELI2 pellino E3 ubiquitin protein ligase family member 2 [ Homo sapiens ] |
| Official Symbol | PELI2 |
| Synonyms | PELI2; pellino E3 ubiquitin protein ligase family member 2; pellino (Drosophila) homolog 2 , pellino homolog 2 (Drosophila); E3 ubiquitin-protein ligase pellino homolog 2; pellino-2; pellino homolog 2; protein pellino homolog 2; |
| Gene ID | 57161 |
| mRNA Refseq | NM_021255 |
| Protein Refseq | NP_067078 |
| UniProt ID | Q9HAT8 |
| ◆ Recombinant Proteins | ||
| PELI2-729Z | Recombinant Zebrafish PELI2 | +Inquiry |
| PELI2-1642H | Recombinant Human PELI2 protein, His-tagged | +Inquiry |
| PELI2-0412H | Recombinant Human PELI2 Protein (F2-D420), Tag Free | +Inquiry |
| PELI2-0413H | Recombinant Human PELI2 Protein (F2-D420), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PELI2-3303HCL | Recombinant Human PELI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PELI2 Products
Required fields are marked with *
My Review for All PELI2 Products
Required fields are marked with *
