Recombinant Human PELP1 protein, His-tagged
| Cat.No. : | PELP1-15H |
| Product Overview : | Recombinant Human PELP1 protein(39-338 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 39-338 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | ESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPV |
| Gene Name | PELP1 proline, glutamate and leucine rich protein 1 [ Homo sapiens ] |
| Official Symbol | PELP1 |
| Synonyms | PELP1; proline, glutamate and leucine rich protein 1; proline, glutamic acid and leucine rich protein 1; proline-, glutamic acid- and leucine-rich protein 1; MNAR; transcription factor HMX3; proline and glutamic acid rich nuclear protein; proline-, glutamic acid-, leucine-rich protein 1; modulator of nongenomic activity of estrogen receptor; modulator of non-genomic activity of estrogen receptor; HMX3; P160; |
| Gene ID | 27043 |
| mRNA Refseq | NM_014389 |
| Protein Refseq | NP_055204 |
| MIM | 609455 |
| UniProt ID | Q8IZL8 |
| ◆ Recombinant Proteins | ||
| PELP1-4033R | Recombinant Rat PELP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PELP1-4373R | Recombinant Rat PELP1 Protein | +Inquiry |
| PELP1-6633M | Recombinant Mouse PELP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PELP1-16H | Recombinant Human PELP1 protein, GST-tagged | +Inquiry |
| PELP1-3373R | Recombinant Rhesus monkey PELP1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PELP1 Products
Required fields are marked with *
My Review for All PELP1 Products
Required fields are marked with *
