Recombinant Human PELP1 protein, His-tagged

Cat.No. : PELP1-15H
Product Overview : Recombinant Human PELP1 protein(39-338 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 39-338 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Purity : 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : ESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPV
Gene Name PELP1 proline, glutamate and leucine rich protein 1 [ Homo sapiens ]
Official Symbol PELP1
Synonyms PELP1; proline, glutamate and leucine rich protein 1; proline, glutamic acid and leucine rich protein 1; proline-, glutamic acid- and leucine-rich protein 1; MNAR; transcription factor HMX3; proline and glutamic acid rich nuclear protein; proline-, glutamic acid-, leucine-rich protein 1; modulator of nongenomic activity of estrogen receptor; modulator of non-genomic activity of estrogen receptor; HMX3; P160;
Gene ID 27043
mRNA Refseq NM_014389
Protein Refseq NP_055204
MIM 609455
UniProt ID Q8IZL8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PELP1 Products

Required fields are marked with *

My Review for All PELP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon