Recombinant Human PENK, His-tagged
Cat.No. : | PENK-177H |
Product Overview : | Recombinant Human Proenkephalin-A/PENK is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu25-Phe267) of Human PENK fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-267 a.a. |
Description : | Proenkephalin-A is a secreted protein that belongs to the opioid neuropeptide precursor family. Proenkephalin-A is an endogenous opioid polypeptide hormone which, via proteolyic cleavage, produces the enkephalin peptides [Met]enkephalin, and to a lesser extent, [Leu]enkephalin. Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. Proenkephalin-A (114-133) and Proenkephalin-A (237-258) increase glutamate release in the striatum. Proenkephalin-A (114-133) decreases GABA concentration in the striatum. |
AA Sequence : | ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSK PEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSS DLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGR PEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRFVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | PENK proenkephalin [ Homo sapiens ] |
Official Symbol | PENK |
Synonyms | PENK; proenkephalin; proenkephalin-A; preproenkephalin; enkephalin A; |
Gene ID | 5179 |
mRNA Refseq | NM_001135690 |
Protein Refseq | NP_001129162 |
MIM | 131330 |
UniProt ID | P01210 |
Chromosome Location | 8q23-q24 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem; |
Function | neuropeptide hormone activity; opioid peptide activity; |
◆ Recombinant Proteins | ||
PENK-4863H | Recombinant Human PENK Protein (Glu25-Ala133), N-His tagged | +Inquiry |
PENK-4035R | Recombinant Rat PENK Protein, His (Fc)-Avi-tagged | +Inquiry |
PENK-1647H | Recombinant Human PENK Protein, His (Fc)-Avi-tagged | +Inquiry |
PENK-1950HFL | Recombinant Full Length Human PENK Protein, C-Flag-tagged | +Inquiry |
PENK-2338H | Recombinant Human PENK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PENK-3298HCL | Recombinant Human PENK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PENK Products
Required fields are marked with *
My Review for All PENK Products
Required fields are marked with *
0
Inquiry Basket