Recombinant Human PENK Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PENK-2338H |
Product Overview : | PENK MS Standard C13 and N15-labeled recombinant protein (NP_001129162) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. |
Molecular Mass : | 30.8 kDa |
AA Sequence : | MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PENK proenkephalin [ Homo sapiens (human) ] |
Official Symbol | PENK |
Synonyms | PENK; proenkephalin; proenkephalin-A; preproenkephalin; enkephalin A; |
Gene ID | 5179 |
mRNA Refseq | NM_001135690 |
Protein Refseq | NP_001129162 |
MIM | 131330 |
UniProt ID | P01210 |
◆ Recombinant Proteins | ||
PENK-1647H | Recombinant Human PENK Protein, His (Fc)-Avi-tagged | +Inquiry |
PENK-4035R | Recombinant Rat PENK Protein, His (Fc)-Avi-tagged | +Inquiry |
PENK-8008H | Recombinant Human PENK protein, His & T7-tagged | +Inquiry |
PENK-12632M | Recombinant Mouse PENK Protein | +Inquiry |
PENK-4375R | Recombinant Rat PENK Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PENK-3298HCL | Recombinant Human PENK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PENK Products
Required fields are marked with *
My Review for All PENK Products
Required fields are marked with *