Recombinant Human PEX13 protein, His-tagged
Cat.No. : | PEX13-2731H |
Product Overview : | Recombinant Human PEX13 protein(253-403 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 253-403 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LLSTHSDEVTDSINWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PEX13 peroxisomal biogenesis factor 13 [ Homo sapiens ] |
Official Symbol | PEX13 |
Synonyms | PEX13; peroxisomal biogenesis factor 13; peroxisome biogenesis factor 13; peroxin-13; peroxisomal membrane protein PEX13; ZWS; NALD; |
Gene ID | 5194 |
mRNA Refseq | NM_002618 |
Protein Refseq | NP_002609 |
UniProt ID | Q92968 |
◆ Recombinant Proteins | ||
PEX13-560H | Recombinant Human PEX13 | +Inquiry |
PEX13-3829H | Recombinant Human PEX13 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX13-3375R | Recombinant Rhesus monkey PEX13 Protein, His-tagged | +Inquiry |
PEX13-3193R | Recombinant Rhesus Macaque PEX13 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX13-10916Z | Recombinant Zebrafish PEX13 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX13-3292HCL | Recombinant Human PEX13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PEX13 Products
Required fields are marked with *
My Review for All PEX13 Products
Required fields are marked with *