Recombinant Human PFKFB1 protein, GST-tagged
Cat.No. : | PFKFB1-7832H |
Product Overview : | Recombinant Human PFKFB1 protein(138-241 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 138-241 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | ERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | PFKFB1 |
Synonyms | PFKFB1; F6PK; HL2K; PFRX; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase 1; 6PF-2-K/Fru-2,6-P2ASE liver isozyme; fructose-6-phosphate,2-kinase:fructose-2,6-bisphosphatase; EC 2.7.1.105; EC 3.1.3.46 |
Gene ID | 5207 |
mRNA Refseq | NM_001271804 |
Protein Refseq | NP_001258733 |
MIM | 311790 |
UniProt ID | P16118 |
◆ Recombinant Proteins | ||
PFKFB1-449H | Recombinant Human PFKFB1 | +Inquiry |
PFKFB1-767H | Recombinant Human PFKFB1 Protein, His-tagged | +Inquiry |
Pfkfb1-4808M | Recombinant Mouse Pfkfb1 Protein, Myc/DDK-tagged | +Inquiry |
PFKFB1-3832H | Recombinant Human PFKFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFKFB1-10192Z | Recombinant Zebrafish PFKFB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKFB1-3276HCL | Recombinant Human PFKFB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFKFB1 Products
Required fields are marked with *
My Review for All PFKFB1 Products
Required fields are marked with *