Recombinant Human PFN1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PFN1-3109H |
Product Overview : | PFN1 MS Standard C13 and N15-labeled recombinant protein (NP_005013) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. |
Molecular Mass : | 15.1 kDa |
AA Sequence : | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PFN1 profilin 1 [ Homo sapiens (human) ] |
Official Symbol | PFN1 |
Synonyms | PFN1; profilin 1; profilin-1; profilin I; |
Gene ID | 5216 |
mRNA Refseq | NM_005022 |
Protein Refseq | NP_005013 |
MIM | 176610 |
UniProt ID | P07737 |
◆ Recombinant Proteins | ||
PFN1-12667M | Recombinant Mouse PFN1 Protein | +Inquiry |
PFN1-3332H | Recombinant Human PFN1 protein, GST-tagged | +Inquiry |
PFN1-1658H | Recombinant Human PFN1, GST-tagged | +Inquiry |
PFN1-91H | Recombinant Human PFN1 protein, His-tagged | +Inquiry |
PFN1-1401H | Recombinant Human Profilin 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN1-3269HCL | Recombinant Human PFN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN1 Products
Required fields are marked with *
My Review for All PFN1 Products
Required fields are marked with *