Recombinant Human PGAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PGAM1-5534H
Product Overview : PGAM1 MS Standard C13 and N15-labeled recombinant protein (NP_002620) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 28.8 kDa
AA Sequence : MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PGAM1 phosphoglycerate mutase 1 [ Homo sapiens (human) ]
Official Symbol PGAM1
Synonyms PGAM1; phosphoglycerate mutase 1 (brain); PGAMA; phosphoglycerate mutase 1; PGAM B; Phosphoglycerate mutase A; nonmuscle form; BPG-dependent PGAM 1; phosphoglycerate mutase isozyme B; phosphoglycerate mutase A, nonmuscle form; PGAM-B;
Gene ID 5223
mRNA Refseq NM_002629
Protein Refseq NP_002620
MIM 172250
UniProt ID P18669

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGAM1 Products

Required fields are marked with *

My Review for All PGAM1 Products

Required fields are marked with *

0
cart-icon