Recombinant Human PGF Protein, His-tagged

Cat.No. : PGF-04H
Product Overview : Recombinant human PIGF (21-170aa), fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-170aa
Description : This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : 18.3kDa (160aa)
AA Sequence : AVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name PGF placental growth factor [ Homo sapiens (human) ]
Official Symbol PGF
Synonyms PGF; placental growth factor; PGFL; PIGF; PLGF; PlGF-2; D12S1900; SHGC-10760; placenta growth factor; placental growth factor, vascular endothelial growth factor-related protein
Gene ID 5228
mRNA Refseq NM_002632
Protein Refseq NP_002623
MIM 601121
UniProt ID P49763

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGF Products

Required fields are marked with *

My Review for All PGF Products

Required fields are marked with *

0
cart-icon