Recombinant Human PGK1 protein, His-tagged
| Cat.No. : | PGK1-192H |
| Product Overview : | Recombinant Human PGK1(Ser2-Ile417) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Ser2-Ile417 |
| Description : | PGK1 is called phosphoglycerate kinase that involved in a critical energy-producing process known as glycolysis. Phosphoglycerate kinase helps carry out a chemical reaction that converts a molecule called 1,3-diphosphoglycerate, which is produced during the breakdown of glucose, to another molecule called 3-phosphoglycerate during glycolysis. PGK1 The encoded protein may also act as a cofactor for polymerase alpha. The protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. |
| Form : | Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,20% glycerol, pH 8.0. |
| AA Sequence : | SLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGR PDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGK GKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNY FAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEE GAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAE AVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSH VSTGGGASLELLEGKVLPGVDALSNILDHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Shipping : | The product is shipped on dry ice/ice packs. |
| Gene Name | PGK1 phosphoglycerate kinase 1 [ Homo sapiens ] |
| Official Symbol | PGK1 |
| Synonyms | PGK1; phosphoglycerate kinase 1; PRP 2; primer recognition protein 2; cell migration-inducing gene 10 protein; PGKA; MIG10; MGC8947; MGC117307; MGC142128; |
| Gene ID | 5230 |
| mRNA Refseq | NM_000291 |
| Protein Refseq | NP_000282 |
| MIM | 311800 |
| UniProt ID | P00558 |
| Chromosome Location | Xq13.3 |
| Pathway | Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; |
| Function | ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| PGK1-4067R | Recombinant Rat PGK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGK1-192H | Recombinant Human PGK1 protein, His-tagged | +Inquiry |
| PGK1-2501H | Recombinant Human PGK1 protein(21-370 aa), C-His-tagged | +Inquiry |
| PGK1-151H | Recombinant Human PGK1 Protein, His-tagged | +Inquiry |
| PGK1-1310H | Recombinant Human PGK1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGK1-547MCL | Recombinant Mouse PGK1 cell lysate | +Inquiry |
| PGK1-271HKCL | Human PGK1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGK1 Products
Required fields are marked with *
My Review for All PGK1 Products
Required fields are marked with *
