Recombinant Human PGK1 protein, His-tagged

Cat.No. : PGK1-192H
Product Overview : Recombinant Human PGK1(Ser2-Ile417) fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Ser2-Ile417
Description : PGK1 is called phosphoglycerate kinase that involved in a critical energy-producing process known as glycolysis. Phosphoglycerate kinase helps carry out a chemical reaction that converts a molecule called 1,3-diphosphoglycerate, which is produced during the breakdown of glucose, to another molecule called 3-phosphoglycerate during glycolysis. PGK1 The encoded protein may also act as a cofactor for polymerase alpha. The protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions.
Form : Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,20% glycerol, pH 8.0.
AA Sequence : SLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGR PDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGK GKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNY FAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEE GAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAE AVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSH VSTGGGASLELLEGKVLPGVDALSNILDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name PGK1 phosphoglycerate kinase 1 [ Homo sapiens ]
Official Symbol PGK1
Synonyms PGK1; phosphoglycerate kinase 1; PRP 2; primer recognition protein 2; cell migration-inducing gene 10 protein; PGKA; MIG10; MGC8947; MGC117307; MGC142128;
Gene ID 5230
mRNA Refseq NM_000291
Protein Refseq NP_000282
MIM 311800
UniProt ID P00558
Chromosome Location Xq13.3
Pathway Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem;
Function ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGK1 Products

Required fields are marked with *

My Review for All PGK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon