Recombinant Human PGK1 protein, His-tagged
Cat.No. : | PGK1-192H |
Product Overview : | Recombinant Human PGK1(Ser2-Ile417) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ser2-Ile417 |
Description : | PGK1 is called phosphoglycerate kinase that involved in a critical energy-producing process known as glycolysis. Phosphoglycerate kinase helps carry out a chemical reaction that converts a molecule called 1,3-diphosphoglycerate, which is produced during the breakdown of glucose, to another molecule called 3-phosphoglycerate during glycolysis. PGK1 The encoded protein may also act as a cofactor for polymerase alpha. The protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,20% glycerol, pH 8.0. |
AA Sequence : | SLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGR PDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGK GKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNY FAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEE GAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAE AVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSH VSTGGGASLELLEGKVLPGVDALSNILDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | PGK1 phosphoglycerate kinase 1 [ Homo sapiens ] |
Official Symbol | PGK1 |
Synonyms | PGK1; phosphoglycerate kinase 1; PRP 2; primer recognition protein 2; cell migration-inducing gene 10 protein; PGKA; MIG10; MGC8947; MGC117307; MGC142128; |
Gene ID | 5230 |
mRNA Refseq | NM_000291 |
Protein Refseq | NP_000282 |
MIM | 311800 |
UniProt ID | P00558 |
Chromosome Location | Xq13.3 |
Pathway | Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity; |
◆ Recombinant Proteins | ||
PGK1-5134H | Recombinant Human PGK1 protein, GST-tagged | +Inquiry |
PGK1-0215H | Recombinant Human PGK1 Protein (S2-I417), His tagged | +Inquiry |
PGK1-1310H | Recombinant Human PGK1 Protein, MYC/DDK-tagged | +Inquiry |
PGK1-431H | Recombinant Human PGK1 Protein, His-tagged | +Inquiry |
PGK1-6577H | Recombinant Human PGK1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGK1-547MCL | Recombinant Mouse PGK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGK1 Products
Required fields are marked with *
My Review for All PGK1 Products
Required fields are marked with *
0
Inquiry Basket