Recombinant Human PGK1 protein, His-tagged

• Cat.No.: PGK1-192H
• Product Overview: Recombinant Human PGK1(Ser2-Ile417) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Ser2-Ile417
• Description: PGK1 is called phosphoglycerate kinase that involved in a critical energy-producing process known as glycolysis. Phosphoglycerate kinase helps carry out a chemical reaction that converts a molecule called 1,3-diphosphoglycerate, which is produced during the breakdown of glucose, to another molecule called 3-phosphoglycerate during glycolysis. PGK1 The encoded protein may also act as a cofactor for polymerase alpha. The protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions.
• Form: Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,20% glycerol, pH 8.0.
• AA Sequence: SLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGR PDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGK GKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNY FAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEE GAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAE AVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSH VSTGGGASLELLEGKVLPGVDALSNILDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.
  Please minimize freeze-thaw cycles.
• Shipping: The product is shipped on dry ice/ice packs.

Gene Information

• Gene Name: PGK1 phosphoglycerate kinase 1 [ Homo sapiens ]
• Official Symbol: PGK1
• Synonyms: PGK1; phosphoglycerate kinase 1; PRP 2; primer recognition protein 2; cell migration-inducing gene 10 protein; PGKA; MIG10; MGC8947; MGC117307; MGC142128
• Gene ID: 5230
• mRNA Refseq: NM_000291
• Protein Refseq: NP_000282
• MIM: 311800
• UniProt ID: P00558
• Chromosome Location: Xq13.3
• Pathway: Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem
• Function: ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity